[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : AAS81764.1
DDBJ      :             GTP-binding protein
Swiss-Prot:OBG_THET2    RecName: Full=GTPase obg;AltName: Full=GTP-binding protein obg;

Homologs  Archaea  66/68 : Bacteria  910/915 : Eukaryota  196/199 : Viruses  0/175   --->[See Alignment]
a.118.1b.117.1c.37.1d.242.1
:416 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->416 1udxA PDBj e-174 97.8 %
:RPS:PDB   96->319 3eg5B PDBj 1e-23 10.4 %
:RPS:SCOP  2->138 1lnzA1  b.117.1.1 * 3e-29 33.6 %
:RPS:SCOP  156->310 1z2cB1  a.118.1.23 * 1e-22 16.7 %
:RPS:SCOP  357->416 1udxA3  d.242.1.1 * 1e-14 100.0 %
:HMM:SCOP  1->156 1udxA1 b.117.1.1 * 2.5e-54 57.1 %
:HMM:SCOP  148->348 1ni3A1 c.37.1.8 * 9.3e-57 44.9 %
:HMM:SCOP  341->416 1udxA3 d.242.1.1 * 3.5e-18 40.8 %
:RPS:PFM   2->138 PF01018 * GTP1_OBG 5e-22 42.3 %
:RPS:PFM   169->245 PF01926 * MMR_HSR1 1e-17 54.5 %
:RPS:PFM   360->412 PF09269 * DUF1967 5e-08 45.3 %
:HMM:PFM   2->156 PF01018 * GTP1_OBG 4.7e-59 56.8 155/156  
:HMM:PFM   169->278 PF01926 * MMR_HSR1 1.2e-26 43.3 104/108  
:HMM:PFM   346->412 PF09269 * DUF1967 3.4e-21 41.8 67/69  
:HMM:PFM   240->322 PF00009 * GTP_EFTU 0.0002 29.5 78/189  
:BLT:SWISS 1->416 OBG_THET2 e-176 100.0 %
:PROS 211->224|PS00905|GTP1_OBG
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS81764.1 GT:GENE AAS81764.1 GT:PRODUCT GTP-binding protein GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION complement(1345790..1347040) GB:FROM 1345790 GB:TO 1347040 GB:DIRECTION - GB:PRODUCT GTP-binding protein GB:PROTEIN_ID AAS81764.1 GB:DB_XREF GI:46197350 LENGTH 416 SQ:AASEQ MFQDVLVITVAAGRGGDGAVSFRREKFVPKGGPDGGDGGRGGSVYLRARGSVDSLSRLSKRTYKAEDGEHGRGSQQHGRGGEDLVIEVPRGTRVFDADTGELLADLTEEGQTVLVARGGAGGRGNMHFVTPTRQAPRFAEAGEEGEKRRLRLELMLIADVGLVGYPNAGKSSLLAAMTRAHPKIAPYPFTTLSPNLGVVEVSEEERFTLADIPGIIEGASEGKGLGLEFLRHIARTRVLLYVLDAADEPLKTLETLRKEVGAYDPALLRRPSLVALNKVDLLEEEAVKALADALAREGLAVLPVSALTGVGLPALKEALHALVRSTPPPEMPKPVPRKEVQAGVEVVPVAEGVYEVRAPEVERYLARIKGDLMEAAGYLQEVFRRQGVEAALRAKGVRAGDLVRIGGLEFEYIPEV GT:EXON 1|1-416:0| SW:ID OBG_THET2 SW:DE RecName: Full=GTPase obg;AltName: Full=GTP-binding protein obg; SW:GN Name=obg; OrderedLocusNames=TT_C1422; SW:KW Complete proteome; Cytoplasm; GTP-binding; Nucleotide-binding. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->416|OBG_THET2|e-176|100.0|416/416| GO:SWS:NREP 3 GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0005525|"GO:GTP binding"|GTP-binding| GO:SWS GO:0000166|"GO:nucleotide binding"|Nucleotide-binding| PROS 211->224|PS00905|GTP1_OBG|PDOC00704| SEG 31->42|ggpdggdggrgg| SEG 68->82|gehgrgsqqhgrgge| SEG 116->124|arggaggrg| SEG 139->154|aeageegekrrlrlel| SEG 327->356|pppempkpvprkevqagvevvpvaegvyev| BL:PDB:NREP 1 BL:PDB:REP 1->416|1udxA|e-174|97.8|412/412| RP:PDB:NREP 1 RP:PDB:REP 96->319|3eg5B|1e-23|10.4|222/337| RP:PFM:NREP 3 RP:PFM:REP 2->138|PF01018|5e-22|42.3|137/156|GTP1_OBG| RP:PFM:REP 169->245|PF01926|1e-17|54.5|77/105|MMR_HSR1| RP:PFM:REP 360->412|PF09269|5e-08|45.3|53/69|DUF1967| HM:PFM:NREP 4 HM:PFM:REP 2->156|PF01018|4.7e-59|56.8|155/156|GTP1_OBG| HM:PFM:REP 169->278|PF01926|1.2e-26|43.3|104/108|MMR_HSR1| HM:PFM:REP 346->412|PF09269|3.4e-21|41.8|67/69|DUF1967| HM:PFM:REP 240->322|PF00009|0.0002|29.5|78/189|GTP_EFTU| GO:PFM:NREP 4 GO:PFM GO:0005525|"GO:GTP binding"|PF01018|IPR006169| GO:PFM GO:0005525|"GO:GTP binding"|PF01926|IPR002917| GO:PFM GO:0005622|"GO:intracellular"|PF01926|IPR002917| GO:PFM GO:0000166|"GO:nucleotide binding"|PF09269|IPR015349| RP:SCP:NREP 3 RP:SCP:REP 2->138|1lnzA1|3e-29|33.6|137/157|b.117.1.1| RP:SCP:REP 156->310|1z2cB1|1e-22|16.7|150/346|a.118.1.23| RP:SCP:REP 357->416|1udxA3|1e-14|100.0|60/76|d.242.1.1| HM:SCP:REP 1->156|1udxA1|2.5e-54|57.1|156/156|b.117.1.1|1/1|Obg GTP-binding protein N-terminal domain| HM:SCP:REP 148->348|1ni3A1|9.3e-57|44.9|198/296|c.37.1.8|1/1|P-loop containing nucleoside triphosphate hydrolases| HM:SCP:REP 341->416|1udxA3|3.5e-18|40.8|76/76|d.242.1.1|1/1|Obg GTP-binding protein C-terminal domain| OP:NHOMO 3212 OP:NHOMOORG 1172 OP:PATTERN 3321222111111131221211132113-32321312212222212222122233333433122-122 3212332333322222222-23222322222222222222333233322332232222222222222222222222222222222222222222222112322222321322222222222222222222232222222211111222222232222111111222232222121222121222232212222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222322122124212222122213222222222112222222222222222222222-33133231223222222222222211223222232222311111111122223223322222222222222222222222222222433322222222222222222222222222222222222232322223232232222222222222222223222222132224222222222222222233224112222222222222222222222222333222232222242222223222232332332-2232322222243333333443333344-44344333444344334444443333333333333333333333444444432333333333333322233333333322333333223322222222222222222223222222223222232222222222222333333333333233322222222222222222222222222222222222222-22222222222222222221111122232222 3322667-94435643332454534345444354444555535543643355533343334365444454434544434445555533-45434344333123566369686B76565423564B7175Gk7-99B33435257344442834A376565AB5464495543677668A*9995876BA38A5664334 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 412 STR:RPRED 99.0 SQ:SECSTR ccHHHHHHHEEcHHHHHHHHHTccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccGGGccHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHTcccHHHHHHHHHHHHHHTccHHHHHHHHTcccHHHHHHHTccTTcHHHHHHHHHHHHHHHTccccTTHHHHHHHHHHHHHHHHTccTTHHHHHTTcTTccHHHHHHHHHHHHHHHTTcccHHHHHHHHHHHHHTTHHHHHHHHTTccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHTcHHHHHHTTTcTTHHHHHHHHHHTTccccccTTHHHHHcc####ccccccccccccccEEEEEETTEEEEEcHHHHHHHTTEEEcTGGGHHHHHHHHHHTTHHHHHHTTTccTTcEEEETTEEEEccccc DISOP:02AL 64-79, 134-152| PSIPRED cEEEEEEEEEEEccccccEEEcccccccccccccccccccccEEEEEEEccccHHHHHcccEEEccccccccccccccccccEEEEEEccccEEEEcccccEEEEEEEcccEEEEEccccccccccccccccccccHHHHcccccccEEEEEEccccccEEEEccccccHHHHHHHHHccccEEcccccccccEEEEEEEEccccEEEEEEcccccccccHHHHHHHHHHHHHHcccEEEEEEEcccccHHHHHHHHHHHHHHcHHHHcccEEEEEcccccccHHHHHHHHHHHHHccccEEEEEccccccHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHcccEEEEEccHHHHHHHHcccccHHHHHHHHHHHHHccHHHHHHHcccccccEEEEccEEEEEcccc //