[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : AAS81777.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.55.5
:109 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  1->77 1eo1A  c.55.5.1 * 6e-08 27.6 %
:HMM:SCOP  1->77 1eo1A_ c.55.5.1 * 9.2e-14 31.6 %
:HMM:PFM   19->71 PF02579 * Nitro_FeMo-Co 1.9e-08 36.0 50/94  
:HMM:PFM   85->106 PF00392 * GntR 0.00062 36.4 22/64  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS81777.1 GT:GENE AAS81777.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION complement(1360024..1360353) GB:FROM 1360024 GB:TO 1360353 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAS81777.1 GB:DB_XREF GI:46197363 LENGTH 109 SQ:AASEQ MRVAIALAKDDATRVYPGPFGHAPRYAIYEAGPSGELVLLEIRENPYAKAHGEEKHAKMRELLRDVDLKVGARFGHKGSLGAFPLADRVEVGPVSLEEALARLKERSSA GT:EXON 1|1-109:0| HM:PFM:NREP 2 HM:PFM:REP 19->71|PF02579|1.9e-08|36.0|50/94|Nitro_FeMo-Co| HM:PFM:REP 85->106|PF00392|0.00062|36.4|22/64|GntR| RP:SCP:NREP 1 RP:SCP:REP 1->77|1eo1A|6e-08|27.6|76/124|c.55.5.1| HM:SCP:REP 1->77|1eo1A_|9.2e-14|31.6|76/124|c.55.5.1|1/1|Nitrogenase accessory factor-like| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 46-52, 105-109| PSIPRED cEEEEEEEEccccEEcccccccccEEEEEEEcccccEEEEEEccccccccccHHHHHHHHHHHHHHHHHHHHHccccccccccccccccEEccccHHHHHHHHHHHccc //