[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : AAS81781.1
DDBJ      :             hydrolase (HAD superfamily)
Swiss-Prot:             

Homologs  Archaea  5/68 : Bacteria  90/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.211.1
:185 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   10->85 2dqbA PDBj 7e-06 15.8 %
:RPS:SCOP  30->118 2paqA1  a.211.1.1 * 2e-05 11.5 %
:HMM:SCOP  10->121 1xx7A_ a.211.1.1 * 0.0004 27.6 %
:HMM:PFM   22->90 PF01966 * HD 1.7e-10 29.0 69/118  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS81781.1 GT:GENE AAS81781.1 GT:PRODUCT hydrolase (HAD superfamily) GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION 1361932..1362489 GB:FROM 1361932 GB:TO 1362489 GB:DIRECTION + GB:PRODUCT hydrolase (HAD superfamily) GB:PROTEIN_ID AAS81781.1 GB:DB_XREF GI:46197367 LENGTH 185 SQ:AASEQ MPSFQEALALMEAWTESASLRRHMRAVEVAMRAYARRYGEDEELWAIAGVLHDMDYEKYPEEHPYRAVEELRRLGYPEEVLEAILGHASYTGTPRRTRMAKALFAVDELTGLITAAVYVRPDRSILGLELPSLKKKFKDKAFAKGVNREEIRLGAEELGVPLEEHMAFVLEAMKQEARLLGLEGA GT:EXON 1|1-185:0| SEG 134->144|kkkfkdkafak| RP:PDB:NREP 1 RP:PDB:REP 10->85|2dqbA|7e-06|15.8|76/359| HM:PFM:NREP 1 HM:PFM:REP 22->90|PF01966|1.7e-10|29.0|69/118|HD| RP:SCP:NREP 1 RP:SCP:REP 30->118|2paqA1|2e-05|11.5|87/177|a.211.1.1| HM:SCP:REP 10->121|1xx7A_|0.0004|27.6|98/0|a.211.1.1|1/1|HD-domain/PDEase-like| OP:NHOMO 107 OP:NHOMOORG 95 OP:PATTERN -----------------------1--------------1111-------------------------- -11----------------------------------------------------------------------------1111-----------------------------------------------------1111111111-------------------------------------11111111------------------------------------------------------------------------------------------------------------------------------------111-12222222-2-22------111--11-1111--11112111121--1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11--111111111-1-1--1---1111--1-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------1111111111-1- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 111 STR:RPRED 60.0 SQ:SECSTR #HHHHHHTTccccccccccHHHHHHHHHHHHHHHHHHTTccHHHHHHHHHHTTTTccccTTHHHHHHHHHTTTTcccHHHHHHHHHTTcccccccccHHHHHHHHHHHHHHH######################################################################### DISOP:02AL 185-186| PSIPRED cccHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHccccccccHHHHHHHHHHHHccccHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHccccHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHccccc //