[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : AAS81782.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:106 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   12->104 PF04930 * FUN14 3.9e-29 36.6 93/100  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS81782.1 GT:GENE AAS81782.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION 1362548..1362868 GB:FROM 1362548 GB:TO 1362868 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAS81782.1 GB:DB_XREF GI:46197368 LENGTH 106 SQ:AASEQ MELPDLTPYLGQITFGGLAGYAVGYALKKVGRLLAIALGLLFVALQLLAQAGYVEVDWTRIQRDVEPLLQQPALRNLWDRLLATLTYNLPFGASFVGGLVLGLRAG GT:EXON 1|1-106:0| TM:NTM 1 TM:REGION 20->42| SEG 16->27|gglagyavgyal| SEG 37->52|algllfvalqllaqag| HM:PFM:NREP 1 HM:PFM:REP 12->104|PF04930|3.9e-29|36.6|93/100|FUN14| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 106-107| PSIPRED ccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEEHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc //