[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : AAS81786.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.113.1
:138 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   27->108 1sz3A PDBj 2e-04 39.7 %
:RPS:PDB   29->129 2azwA PDBj 4e-07 21.8 %
:RPS:SCOP  30->137 2o5fA1  d.113.1.2 * 1e-07 21.9 %
:HMM:SCOP  1->136 1ryaA_ d.113.1.5 * 4e-12 28.2 %
:HMM:PFM   4->126 PF00293 * NUDIX 2e-12 21.5 121/135  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS81786.1 GT:GENE AAS81786.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION 1364845..1365261 GB:FROM 1364845 GB:TO 1365261 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAS81786.1 GB:DB_XREF GI:46197372 LENGTH 138 SQ:AASEQ MPRKRSVALAAWGEEGLLLVLRPQDDPEFPGAWGLPAVSLQGEETLEEAALRVAREKLGAEVAEAGPIAFGVEERPGYTLELWVYEGKLLGRPRLPEPKPGKTYYAAFRFGRPEELKAAARQGSLCSRLFLAVKGLCP GT:EXON 1|1-138:0| SEG 7->21|valaawgeeglllvl| BL:PDB:NREP 1 BL:PDB:REP 27->108|1sz3A|2e-04|39.7|68/155| RP:PDB:NREP 1 RP:PDB:REP 29->129|2azwA|4e-07|21.8|101/146| HM:PFM:NREP 1 HM:PFM:REP 4->126|PF00293|2e-12|21.5|121/135|NUDIX| RP:SCP:NREP 1 RP:SCP:REP 30->137|2o5fA1|1e-07|21.9|105/155|d.113.1.2| HM:SCP:REP 1->136|1ryaA_|4e-12|28.2|131/160|d.113.1.5|1/1|Nudix| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 115 STR:RPRED 83.3 SQ:SECSTR #####################EEEEGGGTTccEEccEEEccTTccHHHHHHHHHHHHHcEEEEEEEEEEEEEEEEEETTTTEEEEEEEEEEEEEEEEEccccccccEEEEEcHHHHHHHcccHHHHHHHEEcHcTT## DISOP:02AL 1-4| PSIPRED ccccEEEEEEEcccccEEEEEEccccccccccccccEEEEcccccHHHHHHHHHHHHHccEEEcccEEccEEEEccccEEEEEEEEcEEEccccccccccccEEEEEEEccccHHHHHHHHcccHHHHHHHHHccccc //