[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : AAS81790.1
DDBJ      :             ribosomal-protein-alanine acetyltransferase
Swiss-Prot:             

Homologs  Archaea  1/68 : Bacteria  255/915 : Eukaryota  40/199 : Viruses  0/175   --->[See Alignment]
d.108.1
:194 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->194 2z0zA PDBj e-112 100.0 %
:RPS:PDB   73->175 3dnsB PDBj 4e-16 17.3 %
:RPS:SCOP  12->172 2fckA1  d.108.1.1 * 4e-20 17.6 %
:HMM:SCOP  2->173 2fckA1 d.108.1.1 * 1.3e-37 35.7 %
:HMM:PFM   113->146 PF00583 * Acetyltransf_1 0.00059 35.3 34/83  
:BLT:SWISS 31->178 YP20_BACLI 4e-10 28.8 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS81790.1 GT:GENE AAS81790.1 GT:PRODUCT ribosomal-protein-alanine acetyltransferase GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION complement(1368943..1369527) GB:FROM 1368943 GB:TO 1369527 GB:DIRECTION - GB:PRODUCT ribosomal-protein-alanine acetyltransferase GB:PROTEIN_ID AAS81790.1 GB:DB_XREF GI:46197376 LENGTH 194 SQ:AASEQ MWAFPERFEGRHVRLEPLALAHLPAFLRHYDPEVYRFLSRAPVAPTEEALRAHLEGLLGEPGRVNWAILFGKEVAGRISVIAPEPEHAKLELGTMLFKPFWGSPANKEAKYLLLRHAFEVLRAERVQFKVDLRNERSQRALEALGAVREGVLRKNRRLPDGAFRDDVVYSVLKEEWPGVKARLEARLYGASGNP GT:EXON 1|1-194:0| BL:SWS:NREP 1 BL:SWS:REP 31->178|YP20_BACLI|4e-10|28.8|146/178| BL:PDB:NREP 1 BL:PDB:REP 1->194|2z0zA|e-112|100.0|194/194| RP:PDB:NREP 1 RP:PDB:REP 73->175|3dnsB|4e-16|17.3|98/125| HM:PFM:NREP 1 HM:PFM:REP 113->146|PF00583|0.00059|35.3|34/83|Acetyltransf_1| RP:SCP:NREP 1 RP:SCP:REP 12->172|2fckA1|4e-20|17.6|159/174|d.108.1.1| HM:SCP:REP 2->173|2fckA1|1.3e-37|35.7|171/0|d.108.1.1|1/1|Acyl-CoA N-acyltransferases (Nat)| OP:NHOMO 378 OP:NHOMOORG 296 OP:PATTERN ------------------------1------------------------------------------- 131-4--1111--------------1------1----111-11-2--1111-1121-2--1--11---32------------------------------132-11---1----------------------------------1-------------------------1------------32211-----122222322-22222322----221---2--1------121-----------------2---------------------1-----111----11111111111111-------------1----1-----------------------------------------------1------2--1112-------11111111111----------1---1------11-2221--1-----11-11-1-1111--1--------111-1------------------------------------1-111-22333332----221-------22-1111--22111111111121-1-----111111111--1-------------------------------1------------------------------------2----1111131111111111112-------------1-1--1--------------------------------11--111------------------------------------------121111111---1----1-----------111111---1--2222121231111111-------------1-----------1111111111----------1111-----------------------------------------1-----1- ----11--------1-1--1111-111----------1111111--11111111------------11-------2---1---------1-11---------1----1-1----------------------------------------------------------------------------1-2-1----1--- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 194 STR:RPRED 100.0 SQ:SECSTR cccccccEEccTEEEEEccGGGHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHTTccEEEEEETTEcEEEEEEEEEEETTTTEEEEEEEEcccccccHHHHHHHHHHHHHHHHHccccEEEEEEETTTTcccHHHHHHTcEEEEEEEEEEEEETTEEEEEEEEEEHHHHccHTTTTEEEcccHHHHcc DISOP:02AL 193-194| PSIPRED ccccccEEEccEEEEEEccHHHHHHHHHHHccHHHHHcccccccccHHHHHHHHHHHHcccccEEEEEEEccEEEEEEEEEEEcccccEEEEEEEEcHHHHcccHHHHHHHHHHHHHHHHcccEEEEEEEcccHHHHHHHHHHcccEEEEEEcccEEEEccEEEEEEEEEEcHHHHHHHHHHHHHHHccccccc //