[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : AAS81795.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:82 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   5->73 PF04134 * DUF393 2.8e-11 34.8 69/113  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS81795.1 GT:GENE AAS81795.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION 1372494..1372742 GB:FROM 1372494 GB:TO 1372742 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAS81795.1 GB:DB_XREF GI:46197382 LENGTH 82 SQ:AASEQ MPLQEASGLDPKALLEELHVLEGDRTHRGYAALLALARRLPLLWPLYPLLLLLVPFGAGERLYRFLAKRRPRARASRGGDHP GT:EXON 1|1-82:0| SEG 30->53|yaallalarrlpllwplyplllll| HM:PFM:NREP 1 HM:PFM:REP 5->73|PF04134|2.8e-11|34.8|69/113|DUF393| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-7, 68-82| PSIPRED ccccccccccHHHHHHHHHHHcccccHHHHHHHHHHHHHccHHHHHHHHHHHHHccccHHHHHHHHHHcccccccccccccc //