[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : AAS81805.1
DDBJ      :             (3R)-hydroxymyristoyl-[acyl carrier protein] dehydratase
Swiss-Prot:FABZ_THET8   RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase;         Short=(3R)-hydroxymyristoyl ACP dehydrase;         EC=4.2.1.-;

Homologs  Archaea  0/68 : Bacteria  782/915 : Eukaryota  24/199 : Viruses  0/175   --->[See Alignment]
d.38.1
:142 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   2->134 1u1zE PDBj 5e-28 49.6 %
:RPS:PDB   1->138 3b7jB PDBj 5e-28 41.2 %
:RPS:SCOP  2->136 1u1zA  d.38.1.6 * 6e-43 48.5 %
:HMM:SCOP  3->139 1mkaA_ d.38.1.2 * 1.3e-43 54.1 %
:RPS:PFM   10->127 PF07977 * FabA 2e-24 59.8 %
:HMM:PFM   10->128 PF07977 * FabA 1.6e-35 51.3 119/138  
:BLT:SWISS 1->142 FABZ_THET8 1e-78 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS81805.1 GT:GENE AAS81805.1 GT:PRODUCT (3R)-hydroxymyristoyl-[acyl carrier protein] dehydratase GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION complement(1386682..1387110) GB:FROM 1386682 GB:TO 1387110 GB:DIRECTION - GB:PRODUCT (3R)-hydroxymyristoyl-[acyl carrier protein] dehydratase GB:PROTEIN_ID AAS81805.1 GB:DB_XREF GI:46197392 LENGTH 142 SQ:AASEQ MDIREILKVLPHRYPFLLVDRVLEADERRFKALKNVTFNEPHFQGHFPGHPVMPGVLILEAMAQAAVGALVRQPGFPQGGLAFLAGVEGARFRRPVYPGDTLILEGELLAFRRGVGKVAVRALVEGEERASATLTFVLQGAS GT:EXON 1|1-142:0| SW:ID FABZ_THET8 SW:DE RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase; EC=4.2.1.-; SW:GN Name=fabZ; OrderedLocusNames=TTHA1815; SW:KW Complete proteome; Cytoplasm; Lipid A biosynthesis; Lipid synthesis;Lyase. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->142|FABZ_THET8|1e-78|100.0|142/142| GO:SWS:NREP 4 GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0009245|"GO:lipid A biosynthetic process"|Lipid A biosynthesis| GO:SWS GO:0008610|"GO:lipid biosynthetic process"|Lipid synthesis| GO:SWS GO:0016829|"GO:lyase activity"|Lyase| BL:PDB:NREP 1 BL:PDB:REP 2->134|1u1zE|5e-28|49.6|131/140| RP:PDB:NREP 1 RP:PDB:REP 1->138|3b7jB|5e-28|41.2|136/150| RP:PFM:NREP 1 RP:PFM:REP 10->127|PF07977|2e-24|59.8|117/127|FabA| HM:PFM:NREP 1 HM:PFM:REP 10->128|PF07977|1.6e-35|51.3|119/138|FabA| RP:SCP:NREP 1 RP:SCP:REP 2->136|1u1zA|6e-43|48.5|134/142|d.38.1.6| HM:SCP:REP 3->139|1mkaA_|1.3e-43|54.1|133/0|d.38.1.2|1/1|Thioesterase/thiol ester dehydrase-isomerase| OP:NHOMO 937 OP:NHOMOORG 806 OP:PATTERN -------------------------------------------------------------------- 1111------------------------------------------------1------------1---1---------111111111111111111--111122211-21111111111111111111211111111111---11111111111111111111111111111111111111111111111112222222211221222121111122111211111111112111111111111111111112-222222-2-2222222212222222221111111111111111111111111111111111111111111111111111111111111111111--1211111111111111111111212111111111112222222222211111111111-22222222111122222222222122--11111111111111111111211111111111111111111111111111111111111111111111111112111111111111111121111111111-1111112111111111111111111111111-2-121111111111111211112111132121111111111111111111111111111111111111111111111111111111111-1111111111-11111111111111111-1111111111111111111111111121111111111111111211111111-12222221222211112222211111111111111111111111111111111111111111111111111211111111111111111111111111111111111111111111--------------1-1-------------------------1111111111121 11------1---------------------------------------------------------------------------------------------------2-------------------------------------------------------------2----1111A111113212-2111----1 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 141 STR:RPRED 99.3 SQ:SECSTR EEHHHHHHHccccTTcccccEEEETTTEEEEEEEEcccccGGGGTccTTcccccHHHHHHHHHHHHHHHHHHHHHHccTEEEEEEEEEEEEEcccccTTcEEEEEEEEEEEETTEEEEEEEEEETTEEEEEEEEEEEEccT# PSIPRED ccHHHHHHHccccccEEEEEEEEEEEccEEEEEEEccccccccccccccccEEEHHHHHHHHHHHHHHHHHHccccccccEEEEEEEcccEEccEEccccEEEEEEEEEEEEccEEEEEEEEEEccEEEEEEEEEEEEEEcc //