Thermus thermophilus HB27 (tthe0)
Gene : AAS81853.1
DDBJ      :             hypothetical protein

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:209 amino acids

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS81853.1 GT:GENE AAS81853.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION 1434791..1435420 GB:FROM 1434791 GB:TO 1435420 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAS81853.1 GB:DB_XREF GI:46197440 LENGTH 209 SQ:AASEQ MGMASDLLERLSEDLEVLSLHTRAYLDEFGTLLCYLEGGRGGGTTLLHAPYTEALPVLQALNGLAFRGRVLLALDPSPLSPTLEGLPLTGPTRAPLEHLLRRHRPDRLLLAFYGQGLGRGFPGGKETEAGWRPLEAEGAPLHLRVRSPTGLLYPERRAYPAWESPPLPVDLPETEGPYLGGVGRALGVPTYGVGLVDLKASLEALFRLF GT:EXON 1|1-209:0| SEG 5->20|sdllerlsedlevlsl| SEG 32->47|llcyleggrgggttll| SEG 93->111|raplehllrrhrpdrllla| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-6| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHHHHHcEEEEEEEcccccccEEEEcccHHHHHHHHHHcccEEccEEEEEEccccccccccccccccccHHHHHHHHHHccccEEEEEEcccHHcccccccccccccccccccccccEEEEEEccccccccccccccccccccccccccccccccccccHHHHcccccccHHHHHHHHHHHHHHcc //