[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : AAS81858.1
DDBJ      :             threonyl-tRNA synthetase
Swiss-Prot:SYT_THET2    RecName: Full=Threonyl-tRNA synthetase;         EC=6.1.1.3;AltName: Full=Threonine--tRNA ligase;         Short=ThrRS;

Homologs  Archaea  68/68 : Bacteria  908/915 : Eukaryota  195/199 : Viruses  0/175   --->[See Alignment]
c.51.1d.104.1d.15.10d.67.1
:659 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->654 1nyrA PDBj e-157 43.6 %
:RPS:PDB   2->57 2dwqA PDBj 1e-06 21.4 %
:RPS:PDB   69->540 2cjaB PDBj 2e-70 13.8 %
:RPS:SCOP  1->59 1nyqA2  d.15.10.1 * 5e-16 28.8 %
:RPS:SCOP  60->251 1nyqA3  d.67.1.1 * 2e-41 46.4 %
:RPS:SCOP  251->549 1evkA2  d.104.1.1 * e-102 42.4 %
:RPS:SCOP  551->656 1evkA1  c.51.1.1 * 1e-26 39.6 %
:HMM:SCOP  1->60 1qf6A2 d.15.10.1 * 1.3e-13 45.0 %
:HMM:SCOP  60->251 1nyrA3 d.67.1.1 * 2.8e-54 45.3 %
:HMM:SCOP  252->544 1nyrA4 d.104.1.1 * 2.5e-91 44.5 %
:HMM:SCOP  547->652 1nj1A1 c.51.1.1 * 6.3e-30 40.6 %
:RPS:PFM   3->60 PF02824 * TGS 3e-06 37.9 %
:RPS:PFM   188->228 PF07973 * tRNA_SAD 2e-05 63.6 %
:RPS:PFM   283->438 PF00587 * tRNA-synt_2b 2e-18 40.4 %
:RPS:PFM   561->644 PF03129 * HGTP_anticodon 1e-13 35.7 %
:HMM:PFM   284->452 PF00587 * tRNA-synt_2b 1e-42 33.5 164/173  
:HMM:PFM   559->644 PF03129 * HGTP_anticodon 1.1e-23 39.5 86/94  
:HMM:PFM   1->60 PF02824 * TGS 6.2e-17 33.3 60/60  
:HMM:PFM   174->228 PF07973 * tRNA_SAD 1.1e-15 36.4 44/44  
:BLT:SWISS 1->659 SYT_THET2 0.0 100.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS81858.1 GT:GENE AAS81858.1 GT:PRODUCT threonyl-tRNA synthetase GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION complement(1438773..1440752) GB:FROM 1438773 GB:TO 1440752 GB:DIRECTION - GB:PRODUCT threonyl-tRNA synthetase GB:PROTEIN_ID AAS81858.1 GB:DB_XREF GI:46197445 LENGTH 659 SQ:AASEQ MTVYLPDGKPLELPEGATAKDVARALGEGWERRAVGAIVDGELYDLLKPLPQGAKVRLLTEKDPEFQTLFRHTLAHVLAQAVKEFFREKGYDPESVRLGVGPVIEKGFYYDIEAPEPLSDEDLPAIEAKMREILKRDLPLRRFVLSREEALARYRGKDPYKTELILEIPEGEEISFYQQGDEAYGFTDLCRGPHVPSTGRIPPHFKLTHVAGAYWRGDENRPMLQRVYGVAFRTAEELKEYLWQLEEAKKRDHRRLGRELELFLIDPMVGKGLVLWLPKGNVVREELMAFMREEQVRRGYQLVTTPHIGSLELYKTSGHYPYYAESQFPPISFKERGEEEEYLLKPMNCPHHIRIYAYRKRSYRELPLRLAEFGTVYRYEKAGELLGLTRVRGFTQDDAHIFCTPEEVKGEFLGVLDLVLKVFATLGLKDYRARIGVRDPKSDKYVGDEAKWALAERQIEEAAAEAGLRYTVEEGDAAFYGPKLDFVVKDALGREWQLGTIQVDYNLPERFGLTYVGKDGEEHRPVMLHRAPFGSLERFIGILIEHFAGDFPLWLAPVQAVVVPVSEKQEGYAREVAGRLKEAGLRAEADTRPERMQARIRDAEVQKVPYVLVVGEREKAEGAVSVRRRKKGNLGTMPLAAFLEGALREYRERRLEPVF GT:EXON 1|1-659:0| SW:ID SYT_THET2 SW:DE RecName: Full=Threonyl-tRNA synthetase; EC=6.1.1.3;AltName: Full=Threonine--tRNA ligase; Short=ThrRS; SW:GN Name=thrS; OrderedLocusNames=TT_C1516; SW:KW Aminoacyl-tRNA synthetase; ATP-binding; Complete proteome; Cytoplasm;Ligase; Metal-binding; Nucleotide-binding; Protein biosynthesis; Zinc. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->659|SYT_THET2|0.0|100.0|659/659| GO:SWS:NREP 7 GO:SWS GO:0004812|"GO:aminoacyl-tRNA ligase activity"|Aminoacyl-tRNA synthetase| GO:SWS GO:0005524|"GO:ATP binding"|ATP-binding| GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0016874|"GO:ligase activity"|Ligase| GO:SWS GO:0046872|"GO:metal ion binding"|Metal-binding| GO:SWS GO:0000166|"GO:nucleotide binding"|Nucleotide-binding| GO:SWS GO:0006412|"GO:translation"|Protein biosynthesis| SEG 163->174|elileipegeei| SEG 453->466|alaerqieeaaaea| BL:PDB:NREP 1 BL:PDB:REP 1->654|1nyrA|e-157|43.6|638/642| RP:PDB:NREP 2 RP:PDB:REP 2->57|2dwqA|1e-06|21.4|56/354| RP:PDB:REP 69->540|2cjaB|2e-70|13.8|434/476| RP:PFM:NREP 4 RP:PFM:REP 3->60|PF02824|3e-06|37.9|58/60|TGS| RP:PFM:REP 188->228|PF07973|2e-05|63.6|33/44|tRNA_SAD| RP:PFM:REP 283->438|PF00587|2e-18|40.4|151/170|tRNA-synt_2b| RP:PFM:REP 561->644|PF03129|1e-13|35.7|84/91|HGTP_anticodon| HM:PFM:NREP 4 HM:PFM:REP 284->452|PF00587|1e-42|33.5|164/173|tRNA-synt_2b| HM:PFM:REP 559->644|PF03129|1.1e-23|39.5|86/94|HGTP_anticodon| HM:PFM:REP 1->60|PF02824|6.2e-17|33.3|60/60|TGS| HM:PFM:REP 174->228|PF07973|1.1e-15|36.4|44/44|tRNA_SAD| GO:PFM:NREP 14 GO:PFM GO:0005524|"GO:ATP binding"|PF07973|IPR012947| GO:PFM GO:0005737|"GO:cytoplasm"|PF07973|IPR012947| GO:PFM GO:0006412|"GO:translation"|PF07973|IPR012947| GO:PFM GO:0016876|"GO:ligase activity, forming aminoacyl-tRNA and related compounds"|PF07973|IPR012947| GO:PFM GO:0043039|"GO:tRNA aminoacylation"|PF07973|IPR012947| GO:PFM GO:0000166|"GO:nucleotide binding"|PF00587|IPR002314| GO:PFM GO:0004812|"GO:aminoacyl-tRNA ligase activity"|PF00587|IPR002314| GO:PFM GO:0005524|"GO:ATP binding"|PF00587|IPR002314| GO:PFM GO:0005737|"GO:cytoplasm"|PF00587|IPR002314| GO:PFM GO:0006412|"GO:translation"|PF00587|IPR002314| GO:PFM GO:0006418|"GO:tRNA aminoacylation for protein translation"|PF00587|IPR002314| GO:PFM GO:0004812|"GO:aminoacyl-tRNA ligase activity"|PF03129|IPR004154| GO:PFM GO:0005524|"GO:ATP binding"|PF03129|IPR004154| GO:PFM GO:0006412|"GO:translation"|PF03129|IPR004154| RP:SCP:NREP 4 RP:SCP:REP 1->59|1nyqA2|5e-16|28.8|59/59|d.15.10.1| RP:SCP:REP 60->251|1nyqA3|2e-41|46.4|179/179|d.67.1.1| RP:SCP:REP 251->549|1evkA2|e-102|42.4|290/291|d.104.1.1| RP:SCP:REP 551->656|1evkA1|1e-26|39.6|106/110|c.51.1.1| HM:SCP:REP 1->60|1qf6A2|1.3e-13|45.0|60/0|d.15.10.1|1/1|TGS-like| HM:SCP:REP 60->251|1nyrA3|2.8e-54|45.3|179/179|d.67.1.1|1/1|ThrRS/AlaRS common domain| HM:SCP:REP 252->544|1nyrA4|2.5e-91|44.5|290/291|d.104.1.1|1/1|Class II aaRS and biotin synthetases| HM:SCP:REP 547->652|1nj1A1|6.3e-30|40.6|106/127|c.51.1.1|1/1|Class II aaRS ABD-related| OP:NHOMO 1710 OP:NHOMOORG 1171 OP:PATTERN 11121121222222211222122111111111112111111111111111111111111111111111 1111411111111111111-11111111111111112211133312112111111112112211112121111111111111111111111111111--1111111111111111111111111211111111111111111111133111121111111111111122111111111111111111111111122222222222222221222222211121111111112211111111111111121121111111121111111112111211111111111111222222222221111111111111111111111111112111111111221111111212111111111121121111112122111111122122111211111111122222222222-11211212221222222222221121211111111111111111111111111111111111111111111111111111111111111111111111112111111121111111221111111111111111111111121111121111111111112211112212211111111111112111121112221222222211111111111112111121111111112222111111111111111-1111111111121111111111111111-11111111111111111111121111111111111111111111111111111111111111111111111111111111212111212111221111222222122111111112111111111111111111111111311111211111111111111111111111111111111111121111111-11111111111111111111111111111121 1111332-311122211222222222222222222122222222223333223212223333222222222122222-2322222222-1311111111111222212B324734643323333573639U3-66B3333933442334333494434313A11121311512322222F2222242442432252223 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 656 STR:RPRED 99.5 SQ:SECSTR ccccccccTTcccccEEETTEEEEEHccHHHHEccTTcccEEEEccGGccccEEEEEEEEccccGcHHEEEcccccTTHHHHHHHHHHHHcccHTGGGTTccTTcccEEEEEEEGGTTccccEEEEEEEEcccccHHHHHHHHHHHHHHHHHccTcHHHccccEEEEEEEEEEEEEEccccccEEcccccccTTEEEEEETTTEEEEEEcccHHHHTTHHHHHHHHHHHHHHHHHTTTcccccEEEEEccccccccccHHHHHcEEEcccTTcEEEcHHHHHHHHHHHHHHHHHTTTTTTcEEccccEEEHHHHHHHTGGGTcGGGccEEcccccHHcccccEEcccccGGGGTTTTcEEEcTTTccEEEEEccEEEccccccccccTTcccEEEEEEEEEEEcHHHHHHHHHHHHHHHHHHHHTcccccEEEEccccEEEEEEEccGGGcTEEEEccGGEEETcccEEEEEEEEcTTHHHHHTTcEETTccccEEEEEEEEHHHHHHHHHHHHcHHTcccGGGccHHHHHHHcccccccHHHHHHHcccGGGccHHHHHHHcccccccHHHHHHHHHHHHTTTcccEEEcccccHHHHHHHHHHTTccEEEEEcHHHHTccEEEEEETTTccEEEEEHHHHHHccTTccHTTccc### DISOP:02AL 215-217, 658-659| PSIPRED cEEEccccEEEEEcccccHHHHHHHHcccccccEEEEEEccEEEEcccccccccEEEEEEcccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccEEEccccccccEEEEEEEccccccHHHHHHHHHHHHHHHHccccEEEEEEcHHHHHHHHHccccHHHHHHHHHccccEEEEEEEcccccEEEEEEcccccccHHHHcccEEEEEccEEEEccccccccEEEEEccccccHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHccccEEEcccHHHHHHHHHHHHHHHHHHcccEEEcccEEEcHHHHHHcccccccccccEEEEcccccccccEEEEEcccHHHHHHHHHHHcccHHHcccEEEEEEEEEEEcccccccccEEHHHHEEcccEEEEcHHHHHHHHHHHHHHHHHHHHHHccEEEEEEEEEcccccccccccHHHHHHHHHHHHHHHHHccccccccccccccccccEEEEEHHHcccEEEEEEEEEcccccEEEEEEEEEccccEEEEEEEEcccHHHHHHHHHHHHHHHccccccccccEEEEEEEccHHHHHHHHHHHHHHHHcccEEEEEcccccHHHHHHHHHHccccEEEEEcccHHHccEEEEEEccccEEEEEcHHHHHHHHHHHHHHHcccccc //