[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : AAS81866.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:189 amino acids
:PSIPRED
:DISOPRED
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS81866.1 GT:GENE AAS81866.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION complement(1445754..1446323) GB:FROM 1445754 GB:TO 1446323 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAS81866.1 GB:DB_XREF GI:46197453 LENGTH 189 SQ:AASEQ MKAVRALALALALVLPGCLPVAMMRPPEPARGAEFSLGATLMPNPFGGQSPVLLLPYLAHAEGDGTLEYNLSLQWGLRGGVKVGLAPGVALDAGLTLPPALGEVADWSWGVPVVLDGGVILGGGGYYLSPRLHLLGVLGGEWGLAYQLSAGVYGGGWVAEVGALGAPGMSGVLFSLSAAWRFGTAPEAP GT:EXON 1|1-189:0| TM:NTM 5 TM:REGION 3->25| TM:REGION 37->59| TM:REGION 79->101| TM:REGION 118->140| TM:REGION 160->182| SEG 3->22|avralalalalvlpgclpva| SEG 110->125|gvpvvldggvilgggg| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4, 187-189| PSIPRED cHHHHHHHHHHHHHccccccEEEcccccccccccEEcccEEccccccccccEEEEEEEEEcccccEEEEEEEEEEcccccEEEEccccEEEEccccccccccccccccccccEEEEccEEEccccEEEcccEEEEEEEcccccEEEEEccccccccHHHHHcccccccccHHHEEEEHHEEcccccccc //