[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : AAS81897.1
DDBJ      :             thioredoxin reductase
Swiss-Prot:             

Homologs  Archaea  68/68 : Bacteria  897/915 : Eukaryota  122/199 : Viruses  0/175   --->[See Alignment]
c.3.1c.4.1
:325 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   10->317 2q7vA PDBj e-111 67.1 %
:RPS:PDB   19->318 2a87B PDBj 2e-61 46.3 %
:RPS:SCOP  17->252 1cjcA2  c.4.1.1 * 1e-23 11.8 %
:HMM:SCOP  1->318 1f8rA1 c.3.1.2 * 2.7e-61 32.1 %
:RPS:PFM   19->291 PF07992 * Pyr_redox_2 8e-17 34.5 %
:HMM:PFM   19->292 PF07992 * Pyr_redox_2 4.4e-45 36.4 195/202  
:BLT:SWISS 15->316 TRXB_STAAR 2e-74 48.0 %
:PROS 147->167|PS00573|PYRIDINE_REDOX_2
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS81897.1 GT:GENE AAS81897.1 GT:PRODUCT thioredoxin reductase GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION complement(1476145..1477122) GB:FROM 1476145 GB:TO 1477122 GB:DIRECTION - GB:PRODUCT thioredoxin reductase GB:PROTEIN_ID AAS81897.1 GB:DB_XREF GI:46197484 LENGTH 325 SQ:AASEQ MEFNLSALGSTPAAEETYDVVIIGGGPAGLTAGIYAGRAQLKTVIVEKGLPGGQIAQTDEVENYPGFPEGISGPELASRMVRQAEKFGARIVMDEVLGLEKAEGGYLVRGYERNYRARAVIVATGANPRRLGVPGEDKFYGRGVSTCATCDGFFYRDKEVVVVGGGDAAVEEGIFLTKFARKVTLVHRRDELRANKVAQKRAFQNPKMHFLFSHVVTEILGEDQVTGVRLKNLKTGEEYVYPTDGVFVFIGHEPNTAFLKGVVELRPDGYIAVRDEVFTSEPGIFAAGDVADPIYRQLTTSVGAGTRAAMMAERYLAEEAEKVKG GT:EXON 1|1-325:0| BL:SWS:NREP 1 BL:SWS:REP 15->316|TRXB_STAAR|2e-74|48.0|300/311| PROS 147->167|PS00573|PYRIDINE_REDOX_2|PDOC00496| SEG 159->173|evvvvgggdaaveeg| BL:PDB:NREP 1 BL:PDB:REP 10->317|2q7vA|e-111|67.1|307/313| RP:PDB:NREP 1 RP:PDB:REP 19->318|2a87B|2e-61|46.3|300/304| RP:PFM:NREP 1 RP:PFM:REP 19->291|PF07992|8e-17|34.5|267/275|Pyr_redox_2| HM:PFM:NREP 1 HM:PFM:REP 19->292|PF07992|4.4e-45|36.4|195/202|Pyr_redox_2| RP:SCP:NREP 1 RP:SCP:REP 17->252|1cjcA2|1e-23|11.8|229/230|c.4.1.1| HM:SCP:REP 1->318|1f8rA1|2.7e-61|32.1|312/371|c.3.1.2|1/1|FAD/NAD(P)-binding domain| OP:NHOMO 1966 OP:NHOMOORG 1087 OP:PATTERN 11121124333333331122111137312423111111111111111211111121121112121111 2331311111121211112-12111211111122222353241231121221432122--2222123241112222222213113---222212221-1212233313121111111111111112222121112311122111223-121111111122211-11212212122222122221213311134444444444444444445552444433353443222227622222222222222222232322122121112233222124323333333233233222222222222332333333333221222222311235333333333323222332223314123244232213312221221212422311111323432222423311111111111133333211122121112231211212111221121111111111111122212221121111111111111111111111222213312112211244242211112279222212335335423232233322321322221222111111111112132211113352354431111111121114113141111111111111111111111111112222223122122222222222222222221-2111111111122221212222222222-2232222222222222223222221122222112111222222122222221111111111111111-2111111111121121111111111-11114333423222223333232232222422211111111111112111112222233344442232222111122111111111111114----1-11111111111111211111111111111111 ----111----122311111111121111111111111111111111111111121111111111111-1221112212211111121-11111111111111221113------------------------------------------------------1------1---11341-111324344132111---3 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 324 STR:RPRED 99.7 SQ:SECSTR #ccccHHTTccccccccEcEEEEccHHHHHHHHHHHHHTTcccEEEcccccccGGGccccccccTTcTTcccHHHHHHHHHHHHHHTTcEEEcccEEEEcccccEEEEETTccEEEEcEEEEcccEEEcccccTHHHHTcTTTEEccHHHHGGGGTTcEEEEEcccHHHHHHHHHHTTTccEEEEEcccccccccTTHHHHHHHcTTEEEEccEEEEEEEccccccEEEEEEETTcccEEEccccEEEcccEEEccTTTTTccccTTccccccTTccccccTTEEEcGGGTccccccHHHHHHHHHHHHHHHHHHHHHHHHcccH DISOP:02AL 1-3, 5-12, 320-325| PSIPRED ccccHHHccccccHHHcccEEEEcccHHHHHHHHHHHHccccEEEEEccccccEEEEEccccccccccccccHHHHHHHHHHHHHHcccEEEEEEEEEEEEcccEEEEEEccEEEEEEEEEEEccccccccccccccHHccccEEEEHHHHHHHHcccEEEEEcccHHHHHHHHHHHHcccEEEEEEEcccccccHHHHHHHHHccccEEEEccEEEEEEEcccEEEEEEEEcccccEEEEEEEEEEEEEEEEEcHHHHHccEEEccccEEEEccccccccccEEEEEEcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccc //