[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : AAS81903.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:73 amino acids
:PSIPRED
:DISOPRED
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS81903.1 GT:GENE AAS81903.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION 1482806..1483027 GB:FROM 1482806 GB:TO 1483027 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAS81903.1 GB:DB_XREF GI:46197490 LENGTH 73 SQ:AASEQ MEGVRERRLEALLLQALGQERTLEELHAALKPLHPGLTKAHLFALLVRLKREGKVAFQGGRFRLAGKDQGADP GT:EXON 1|1-73:0| SEG 2->21|egvrerrlealllqalgqer| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-6, 68-73| PSIPRED cccHHHHHHHHHHHHHHcccccHHHHHHHHHcccccHHHHHHHHHHHHHHHcccEEEcccEEEEccccccccc //