[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : AAS81921.1
DDBJ      :             hypothetical exported protein
Swiss-Prot:             

Homologs  Archaea  3/68 : Bacteria  324/915 : Eukaryota  180/199 : Viruses  0/175   --->[See Alignment]
c.47.1
:194 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   26->194 2k6vA PDBj 1e-96 99.4 %
:RPS:PDB   36->194 2b7kB PDBj 2e-17 31.2 %
:RPS:SCOP  40->194 1xzoA1  c.47.1.10 * 3e-21 22.7 %
:HMM:SCOP  33->194 2b7kA1 c.47.1.10 * 1.9e-41 48.1 %
:RPS:PFM   50->166 PF02630 * SCO1-SenC 7e-31 50.4 %
:HMM:PFM   50->176 PF02630 * SCO1-SenC 7.1e-39 42.1 126/174  
:BLT:SWISS 40->180 SCO22_RICBR 1e-23 39.3 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS81921.1 GT:GENE AAS81921.1 GT:PRODUCT hypothetical exported protein GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION complement(1497959..1498543) GB:FROM 1497959 GB:TO 1498543 GB:DIRECTION - GB:PRODUCT hypothetical exported protein GB:PROTEIN_ID AAS81921.1 GB:DB_XREF GI:46197508 LENGTH 194 SQ:AASEQ MKRLLPAFLLVLALLALAYLLLPRGHTFYGTRLLNPKPVDFALEGPQGPVRLSQFQDKVVLLFFGFTHCPDVCPTTLLALKRAYEKLPPKAQERVQVIFVSVDPERDPPEVADRYAKAFHPSFLGLSGSPEAVREAAQTFGVFYQKSQYRGPGEYLVDHTATTFVVKEGRLVLLYSPDKAEATDRVVADLQALL GT:EXON 1|1-194:0| BL:SWS:NREP 1 BL:SWS:REP 40->180|SCO22_RICBR|1e-23|39.3|140/204| TM:NTM 1 TM:REGION 4->25| SEG 4->22|llpafllvlallalaylll| BL:PDB:NREP 1 BL:PDB:REP 26->194|2k6vA|1e-96|99.4|169/172| RP:PDB:NREP 1 RP:PDB:REP 36->194|2b7kB|2e-17|31.2|157/164| RP:PFM:NREP 1 RP:PFM:REP 50->166|PF02630|7e-31|50.4|117/164|SCO1-SenC| HM:PFM:NREP 1 HM:PFM:REP 50->176|PF02630|7.1e-39|42.1|126/174|SCO1-SenC| RP:SCP:NREP 1 RP:SCP:REP 40->194|1xzoA1|3e-21|22.7|154/172|c.47.1.10| HM:SCP:REP 33->194|2b7kA1|1.9e-41|48.1|160/0|c.47.1.10|1/1|Thioredoxin-like| OP:NHOMO 731 OP:NHOMOORG 507 OP:PATTERN ------------------211----------------------------------------------- ----1------------------------------------322------------------1----1111------------11111------------------------------------------------22211---12-------------------------------------32211----1-------------------------111----------1---------------------------------------------------------------------------------------------------------------------------------------------2--1221111112-1111111111211111111112-43334132211121131111111121111512111111211111111211-121111111111111111111111111111111-1221-222222222223222222223232322221111111113111121211111311111111111111131141--------------------------------111------1----------------11-121121112111111111112111111---1211--------------------------------------------------------------------------------------------1-----1111111---------------------------1111113232133332322---------1111111111111112212122111-111111-221111------------------------------------------------- 11--111-513-11111112111-111111111111-1111111-11111-111-1111111111111-1221112212211111111-11111-11111111221-1-1222132-1111131231214A2-213-21212222121212212231133421111-11-811211111J1111112131231131111 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 169 STR:RPRED 87.1 SQ:SECSTR #########################ccccccccTTccccccEEEETTcEEEGGGGTTccEEEEEEcTTcccHHHHHHHHHHHHHHHHHHHcccccEEEEEEccTTTccHHHHHHHHTTccTTcEEEEccHHHHHHHHHHTTccccccccccTTcccccccccEEEETTccEEEEEcTTccccHHHHHHHHHHHH PSIPRED cHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccEEEEcccccEEHHHHcccEEEEEEEccccccccHHHHHHHHHHHHHHHHHHcccEEEEEEEEccccccHHHHHHHHHHHccccEEEEccHHHHHHHHHHcccEEEEccccccccEEEEEEEEEEEEccccEEEEEcccccccHHHHHHHHHHHc //