[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : AAS81924.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:147 amino acids
:PSIPRED
:DISOPRED
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS81924.1 GT:GENE AAS81924.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION 1499355..1499798 GB:FROM 1499355 GB:TO 1499798 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAS81924.1 GB:DB_XREF GI:46197511 LENGTH 147 SQ:AASEQ MRRAALFLILPFFLQLLGLGDTPLGGGLCGEVFRVQDPAFALKTPGFWYGLLFMVLLALELGYGLSLLLLPLLEVRPGKGWVRAGRYLVGTLFLLFLLTRTTGLPTPGPGGWTLEPAPLDPLSLLLVGLSLAGGLLLKENGEHGAAS GT:EXON 1|1-147:0| TM:NTM 4 TM:REGION 4->26| TM:REGION 51->73| TM:REGION 82->103| TM:REGION 118->140| SEG 6->30|lflilpfflqllglgdtplggglcg| SEG 56->73|llalelgyglsllllpll| SEG 88->137|lvgtlfllflltrttglptpgpggwtlepapldplslllvglslagglll| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2, 140-147| PSIPRED ccHHHHHHHHHHHHHHHccccccccccHHHHHHccccHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHcccccccccccEEccccccHHHHHHHHHHHHccEEEEEcccccccc //