[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : AAS81929.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:163 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   48->86 PF09924 * DUF2156 0.00025 38.5 39/298  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS81929.1 GT:GENE AAS81929.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION complement(1502095..1502586) GB:FROM 1502095 GB:TO 1502586 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAS81929.1 GB:DB_XREF GI:46197516 LENGTH 163 SQ:AASEQ MVRSFLSLHVQAPLEAVAAWAEGRTGGTGVYLVPDPPWTSLYHEALEAEEDPEAIRAFLRELSRLGQALAFLVLSEEDLLFLLAEGGEVRAELRAGPELGTALKAPADLAPLLTRAQALPPEHAVRALAARFGLHPDHALLGFADLLEAEEEEGLPEEVVYLE GT:EXON 1|1-163:0| SEG 72->85|lvlseedllfllae| SEG 102->113|alkapadlapll| SEG 140->162|llgfadlleaeeeeglpeevvyl| HM:PFM:NREP 1 HM:PFM:REP 48->86|PF09924|0.00025|38.5|39/298|DUF2156| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 162-164| PSIPRED cHHHHHHHHHHcHHHHHHHHHcccccccEEEEcccccHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHcccHHHHHHHHccHHHHHHccHHHHHHHHHHHHcccHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHccccccEEEcc //