[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : AAS81938.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:154 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   40->94 PF03616 * Glt_symporter 1.8e-05 41.5 53/368  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS81938.1 GT:GENE AAS81938.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION 1512644..1513108 GB:FROM 1512644 GB:TO 1513108 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAS81938.1 GB:DB_XREF GI:46197525 LENGTH 154 SQ:AASEQ MLTWVDLLALMVLALSLALGYRGGLVLAWVGLLGLPLYAAALALGLPAFWTALAVGLVLGALAKSLPLFLSEAAERGLGLLGGGLLGLFLAAAIWTGFPSEPAPSGGIRYPSLRLPTPIYQGVAQSPFARRVFAWAWGTPWARKALGLEGQHLR GT:EXON 1|1-154:0| TM:NTM 4 TM:REGION 1->21| TM:REGION 24->46| TM:REGION 50->72| TM:REGION 77->99| SEG 7->19|llalmvlalslal| SEG 23->48|gglvlawvgllglplyaaalalglpa| SEG 52->63|alavglvlgala| SEG 77->88|glgllgggllgl| HM:PFM:NREP 1 HM:PFM:REP 40->94|PF03616|1.8e-05|41.5|53/368|Glt_symporter| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 152-154| PSIPRED ccHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHcccccccccccccccccccccHHHHHHHccHHHHHHHHHHcccHHHHHHHcccccccc //