[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : AAS81942.1
DDBJ      :             Inorganic pyrophosphatase
Swiss-Prot:IPYR_THET8   RecName: Full=Inorganic pyrophosphatase;         EC=3.6.1.1;AltName: Full=Pyrophosphate phospho-hydrolase;         Short=PPase;

Homologs  Archaea  46/68 : Bacteria  611/915 : Eukaryota  14/199 : Viruses  0/175   --->[See Alignment]
b.40.5
:175 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   2->175 2prdA PDBj 2e-89 100.0 %
:RPS:PDB   3->174 2au7A PDBj 2e-50 42.4 %
:RPS:SCOP  3->174 1fajA  b.40.5.1 * 1e-49 38.9 %
:HMM:SCOP  4->175 8prkA_ b.40.5.1 * 4.2e-66 47.7 %
:RPS:PFM   18->174 PF00719 * Pyrophosphatase 6e-29 45.8 %
:HMM:PFM   18->174 PF00719 * Pyrophosphatase 1.8e-60 50.3 155/156  
:BLT:SWISS 1->175 IPYR_THET8 2e-89 100.0 %
:PROS 66->72|PS00387|PPASE
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS81942.1 GT:GENE AAS81942.1 GT:PRODUCT Inorganic pyrophosphatase GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION complement(1515404..1515931) GB:FROM 1515404 GB:TO 1515931 GB:DIRECTION - GB:PRODUCT Inorganic pyrophosphatase GB:PROTEIN_ID AAS81942.1 GB:DB_XREF GI:46197529 LENGTH 175 SQ:AASEQ MANLKSLPVGDKAPEVVHMVIEVPRGSGNKYEYDPDLGAIKLDRVLPGAQFYPGDYGFIPSTLAEDGDPLDGLVLSTYPLLPGVVVEVRVVGLLLMEDEKGGDAKVIGVVAEDQRLDHIQDIGDVPEGVKQEIQHFFETYKALEAKKGKWVKVTGWRDRKAALEEVRACIARYKG GT:EXON 1|1-175:0| SW:ID IPYR_THET8 SW:DE RecName: Full=Inorganic pyrophosphatase; EC=3.6.1.1;AltName: Full=Pyrophosphate phospho-hydrolase; Short=PPase; SW:GN Name=ppa; OrderedLocusNames=TTHA1965; SW:KW 3D-structure; Complete proteome; Cytoplasm; Direct protein sequencing;Hydrolase; Magnesium; Metal-binding. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->175|IPYR_THET8|2e-89|100.0|175/175| GO:SWS:NREP 3 GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0016787|"GO:hydrolase activity"|Hydrolase| GO:SWS GO:0046872|"GO:metal ion binding"|Metal-binding| PROS 66->72|PS00387|PPASE|PDOC00325| SEG 79->95|pllpgvvvevrvvglll| BL:PDB:NREP 1 BL:PDB:REP 2->175|2prdA|2e-89|100.0|174/174| RP:PDB:NREP 1 RP:PDB:REP 3->174|2au7A|2e-50|42.4|170/175| RP:PFM:NREP 1 RP:PFM:REP 18->174|PF00719|6e-29|45.8|155/156|Pyrophosphatase| HM:PFM:NREP 1 HM:PFM:REP 18->174|PF00719|1.8e-60|50.3|155/156|Pyrophosphatase| GO:PFM:NREP 4 GO:PFM GO:0000287|"GO:magnesium ion binding"|PF00719|IPR008162| GO:PFM GO:0004427|"GO:inorganic diphosphatase activity"|PF00719|IPR008162| GO:PFM GO:0005737|"GO:cytoplasm"|PF00719|IPR008162| GO:PFM GO:0006796|"GO:phosphate metabolic process"|PF00719|IPR008162| RP:SCP:NREP 1 RP:SCP:REP 3->174|1fajA|1e-49|38.9|167/168|b.40.5.1| HM:SCP:REP 4->175|8prkA_|4.2e-66|47.7|172/0|b.40.5.1|1/1|Inorganic pyrophosphatase| OP:NHOMO 744 OP:NHOMOORG 671 OP:PATTERN 111111111111111111----1-11111111111---------------12111111111111-1-1 1131211111111111111-11111111111111111111111111111111-1111122111111111111111111----111111-----------1-1111121121111111--------11111111111111111111-1111111111122222211111111221222222222---11----1-----------------1-------111----------------------------------------------------------------------------------------------------------------------------------1---1-----------------1--111111111212111111111111111111112-11111211121111111111111111111----------111111111111111111111111111111111111111111111-1111111111111111111111111111111111111111111111111111111111111111111111--11111-----------------------222211---1111111111111111112-111-11111111-11--1------------------1-1111111111111111211111111111-11111111111111111112221211111111111111111111111111111111111111111111111111111111121111111111111111111111111111111111121111112121111111111---11111111-1122111111111111111---1111----------111111-1111111111111111111-1--------1-- -------------------------------------------------------------------------------------------------------------2---------------------------------------------------------------11-11-----114695-53--1---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 175 STR:RPRED 100.0 SQ:SECSTR EccGGGccccccTTTcEEEEEEEcTTcccEEEEcTTTccEEEEEEcccccccccEEEEcTTcccTTccccEEEEcccccccTTcEEEEEEEEEEEEEETTEEccEEEEcTTTccTTTTcccGGGccHHHHHHHHHHHHHTTTTcGGTTccEEEEEEEcHHHHHHHHHHHHHHHHc DISOP:02AL 1-2| PSIPRED ccccHHcccccccccEEEEEEEEcccccccEEEEcccccEEEccccccccccccccccccccccccccEEEEEEEccccccccEEEEEEEEEEEEEEcccccccEEEEEccccccccccccHHHHHHHHHHHHHHHHHHccccccccccEEEEEccccHHHHHHHHHHHHHHHcc //