Thermus thermophilus HB27 (tthe0)
Gene : AAS81943.1
DDBJ      :             hypothetical protein

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:208 amino acids

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS81943.1 GT:GENE AAS81943.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION 1515964..1516590 GB:FROM 1515964 GB:TO 1516590 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAS81943.1 GB:DB_XREF GI:46197530 LENGTH 208 SQ:AASEQ MGKYEAELARLGERPLAQLEGPEGLLAVTETALLFLSDQGVQRLELARIRRVTRGEGGTVLVQGDAEALSIPLKAFPLEELKAFLEGLKPHVARAKKATAAPRPEPPKPPAQEAKAPVWEEEPPAKTPSVELAPEEPPPAPTPTPPPPAQGTRNPLALPLRLLALLTLAYAVGFAATHPDADPWVLGGVVLGGLTLALTAWSSATSSR GT:EXON 1|1-208:0| SEG 93->117|arakkataaprpeppkppaqeakap| SEG 133->149|apeepppaptptppppa| SEG 156->171|lalplrllalltlaya| SEG 185->207|vlggvvlggltlaltawssatss| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-6, 93-156, 205-208| PSIPRED cccHHHHHHHHccccHHHccccccEEEHHHHEEEEEccccHHHHHHHHHHHHHcccccEEEEEccccEEEEccccccccccHHHHccccccccccEEcccccccccccccccccccccccccccccccEEEEEEcccccccccccccccccccccccHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHcHHcccc //