[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : AAS81962.1
DDBJ      :             glutamyl-tRNA(Gln) amidotransferase subunit B
Swiss-Prot:GATB_THET2   RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B;         Short=Asp/Glu-ADT subunit B;         EC=6.3.5.-;

Homologs  Archaea  64/68 : Bacteria  720/915 : Eukaryota  181/199 : Viruses  0/175   --->[See Alignment]
a.182.1d.128.1
:469 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   2->403 3h0lB PDBj e-104 47.8 %
:RPS:PDB   2->400 2dqnB PDBj e-139 44.8 %
:RPS:SCOP  2->288 2df4B2  d.128.1.5 * e-120 50.7 %
:RPS:SCOP  289->391 2df4B1  a.182.1.2 * 1e-13 31.4 %
:HMM:SCOP  3->288 2f2aB2 d.128.1.5 * 3.8e-115 59.6 %
:HMM:SCOP  314->467 1ng6A_ a.182.1.1 * 2.2e-22 31.7 %
:RPS:PFM   5->283 PF02934 * GatB_N 1e-88 57.6 %
:RPS:PFM   336->466 PF02637 * GatB_Yqey 3e-21 39.7 %
:HMM:PFM   3->283 PF02934 * GatB_N 5.9e-118 60.7 280/289  
:HMM:PFM   328->466 PF02637 * GatB_Yqey 1.3e-42 49.3 138/149  
:BLT:SWISS 1->469 GATB_THET2 0.0 100.0 %
:PROS 137->151|PS01234|GATB
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS81962.1 GT:GENE AAS81962.1 GT:PRODUCT glutamyl-tRNA(Gln) amidotransferase subunit B GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION complement(1539340..1540749) GB:FROM 1539340 GB:TO 1540749 GB:DIRECTION - GB:PRODUCT glutamyl-tRNA(Gln) amidotransferase subunit B GB:PROTEIN_ID AAS81962.1 GB:DB_XREF GI:46197549 LENGTH 469 SQ:AASEQ MYEAVIGLEVHLHLKTRTKMFCGCRADYFGAEPNTHTCPVCLGLPGALPVPNRVAVEHGLRLALALGAEVPERLVFHRKNYFYPDLPKNYQISQYDLPLGRGGSLPLGERRVRIKRLHLEEDAGKSLHLEGRTLLDLNRAGSPLIELVTEPDLKTPEEARLFLQRIQALVQTLGISDASPEEGKLRADVNVSVRRVGEPLGTKVEIKNLNSFKSVQRALEYEIRRQTEILRRGEKVKQATMGFEEGSGKTYPMRTKEEEADYRYFPEPDLPPVVIPRDWLEEVRRSLPELPWEKEARYRALGIKEKDAEVLAYTPSLARFLDQALPLGLASPQALANWLLADVAGLLHERGLRLEETRLSPEGLARLVGLFERGEVTSRVAKSLLPEVLEGQDPEALVRERGLKVVADEGALKALVAEAIAAMPEAAESVRQGKVKALDALVGQVMRKTRGQARPDLVRRLLLEALGVG GT:EXON 1|1-469:0| SW:ID GATB_THET2 SW:DE RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B; Short=Asp/Glu-ADT subunit B; EC=6.3.5.-; SW:GN Name=gatB; OrderedLocusNames=TT_C1620; SW:KW ATP-binding; Complete proteome; Ligase; Nucleotide-binding;Protein biosynthesis. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->469|GATB_THET2|0.0|100.0|469/469| GO:SWS:NREP 4 GO:SWS GO:0005524|"GO:ATP binding"|ATP-binding| GO:SWS GO:0016874|"GO:ligase activity"|Ligase| GO:SWS GO:0000166|"GO:nucleotide binding"|Nucleotide-binding| GO:SWS GO:0006412|"GO:translation"|Protein biosynthesis| PROS 137->151|PS01234|GATB|PDOC00948| SEG 97->111|lplgrggslplgerr| SEG 346->359|llherglrleetrl| SEG 411->428|alkalvaeaiaampeaae| BL:PDB:NREP 1 BL:PDB:REP 2->403|3h0lB|e-104|47.8|400/410| RP:PDB:NREP 1 RP:PDB:REP 2->400|2dqnB|e-139|44.8|397/405| RP:PFM:NREP 2 RP:PFM:REP 5->283|PF02934|1e-88|57.6|278/288|GatB_N| RP:PFM:REP 336->466|PF02637|3e-21|39.7|131/148|GatB_Yqey| HM:PFM:NREP 2 HM:PFM:REP 3->283|PF02934|5.9e-118|60.7|280/289|GatB_N| HM:PFM:REP 328->466|PF02637|1.3e-42|49.3|138/149|GatB_Yqey| GO:PFM:NREP 4 GO:PFM GO:0006412|"GO:translation"|PF02934|IPR006075| GO:PFM GO:0016874|"GO:ligase activity"|PF02934|IPR006075| GO:PFM GO:0006412|"GO:translation"|PF02637|IPR018027| GO:PFM GO:0016884|"GO:carbon-nitrogen ligase activity, with glutamine as amido-N-donor"|PF02637|IPR018027| RP:SCP:NREP 2 RP:SCP:REP 2->288|2df4B2|e-120|50.7|286/292|d.128.1.5| RP:SCP:REP 289->391|2df4B1|1e-13|31.4|102/107|a.182.1.2| HM:SCP:REP 3->288|2f2aB2|3.8e-115|59.6|285/0|d.128.1.5|1/1|Glutamine synthetase/guanido kinase| HM:SCP:REP 314->467|1ng6A_|2.2e-22|31.7|139/148|a.182.1.1|1/1|GatB/YqeY motif| OP:NHOMO 1068 OP:NHOMOORG 965 OP:PATTERN 22121222222222221-11111222222222112222222221111222222111111-11-1-211 1111111111111111111-1111111111111111111111111111111111111111111111111111111111-111111111--------1--------1112111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-2111111111111-111---11211111122211111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111122111111111111111111111111211----11--------------------------11111---------------------------------------------------------------------------------------------11111111111111---------------111111111111111111111111111111111111111----------------------------11111111111111111111-----1-11111111111111111111111111111111 11--111-1-----1111111111111111111111111111111111111111111-1111111111111111121-1111111112-1211111111-111111-1-1121112111111113-111181-1111111211211111111111111113111111111A11-11-12E2221111131421111112 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 410 STR:RPRED 87.4 SQ:SECSTR HcEEEEEEEEEEEcccccccccccccccccccTTccccTTTTTcTTccccccHHHHHHHHHHHHTTTcEEccEEccEEEEcccTTccccEEEEccccccEEEEEEEEEcccEEEEEEEEEEcccEEEEETTEEEEEcccTTcEEEEEEEcTTcccHHHHHHHHHHHHHHHHHTTcccccTTTTcEEEEEEEEEEcTTcccccEEEEEEEccHHHHHHHHHHHHHHHHHHHHHcccccEEEEEEcTTTccEEEEEEcccccccccEEcTTcccEEccHHHHHHHHHTccccHHHHHHHHcTTcccHHHHHHHTccHHHHHHHHHHHHHTcccHHHHHHHHHTTHHHHHHHHTcccTTTcccHHHHHHHHHHHHTTcccGGGHHHHHHHHHHccccTTHHHHTccccEEEEE########################################################### PSIPRED ccccEEEEEEEEEEccccccccccccccccccccccccEEEcccccccccccHHHHHHHHHHHHHHccEEccEEEEEEEEEEccccccccHHHHHcccEEcccEEEEccEEEEEEEEEEEEccccEEEccccEEEEEccccccEEEEEcccccccHHHHHHHHHHHHHHHHHHcccccccccccEEEEEEEEEcccccccccEEEEcccccHHHHHHHHHHHHHHHHHHHHHccEEEHHHHcccccccEEEEccccccccccccccccccccEEEcHHHHHHHHHHccccHHHHHHHHHHccccHHHHHHHHccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHccccHHHccccHHHHHHHHHHHHcccccHHHHHHHHHHHHccccHHHHHHHHccEEcccHHHHHHHHHHHHHHcHHHHHHHHcccHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHccc //