[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : AAS81968.1
DDBJ      :             cold shock protein
Swiss-Prot:             

Homologs  Archaea  2/68 : Bacteria  698/915 : Eukaryota  34/199 : Viruses  1/175   --->[See Alignment]
b.40.4
:68 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   3->66 1g6pA PDBj 1e-19 62.9 %
:RPS:PDB   1->68 1c9oA PDBj 7e-20 60.6 %
:RPS:SCOP  1->68 1c9oA  b.40.4.5 * 3e-20 60.6 %
:HMM:SCOP  1->69 2es2A1 b.40.4.5 * 4.1e-23 56.7 %
:RPS:PFM   4->65 PF00313 * CSD 3e-15 71.7 %
:HMM:PFM   1->67 PF00313 * CSD 3.6e-31 60.0 65/67  
:BLT:SWISS 1->67 CSPA_LISMO 4e-21 63.1 %
:PROS 15->33|PS00352|COLD_SHOCK

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS81968.1 GT:GENE AAS81968.1 GT:PRODUCT cold shock protein GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION complement(1546583..1546789) GB:FROM 1546583 GB:TO 1546789 GB:DIRECTION - GB:PRODUCT cold shock protein GB:PROTEIN_ID AAS81968.1 GB:DB_XREF GI:46197555 LENGTH 68 SQ:AASEQ MNKGIVKWFNAEKGYGFIQQEEGPDVFVHFSAIEADGFRTLSEGERVEFEVEPGRNGKGPQARRVRRL GT:EXON 1|1-68:0| BL:SWS:NREP 1 BL:SWS:REP 1->67|CSPA_LISMO|4e-21|63.1|65/66| PROS 15->33|PS00352|COLD_SHOCK|PDOC00304| BL:PDB:NREP 1 BL:PDB:REP 3->66|1g6pA|1e-19|62.9|62/66| RP:PDB:NREP 1 RP:PDB:REP 1->68|1c9oA|7e-20|60.6|66/66| RP:PFM:NREP 1 RP:PFM:REP 4->65|PF00313|3e-15|71.7|60/67|CSD| HM:PFM:NREP 1 HM:PFM:REP 1->67|PF00313|3.6e-31|60.0|65/67|CSD| GO:PFM:NREP 2 GO:PFM GO:0003677|"GO:DNA binding"|PF00313|IPR002059| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF00313|IPR002059| RP:SCP:NREP 1 RP:SCP:REP 1->68|1c9oA|3e-20|60.6|66/66|b.40.4.5| HM:SCP:REP 1->69|2es2A1|4.1e-23|56.7|67/0|b.40.4.5|1/1|Nucleic acid-binding proteins| OP:NHOMO 2325 OP:NHOMOORG 735 OP:PATTERN ------------------------------------------------------------------11 553-711222211123322-24223322222333337575233442211223354213--443-5468862--112221-21411122-------------11-1---21---------------11112122211-----------1-----------------------------------32122--2123666666666666676213333667211436233333365-33333333333332222235-113311-1-4311334212212561111111--------------1111111111111-11222111312222222222211-1445211-5-1-2-11--11241-3421111121121-33341111132C66C445544633233333232-44264334473-4443655676853312232565454332222222223333322------------1111111111111111122232155555666566533324467444434557586512444111--------3212323231111111224233-4526-----1----666334653555561551-------------------1---1114433564349B433333332332333333411-121311122245445637557755-66-568555577557755765645444556555544544455555575545555319747876576881122-----6665245462221222111111123422423334445555666656666555522222222224448444444444433333333332222115-----------------11111----1--------1-------2311122222--- --11----------1-------1---------------------------1---------------------------------------------------------4--21-------------------------------------------------1211-111-121----1A111123144-3422----1 ---------------------------------------------------------------------------------------1--------------------------------------------------------------------------------------- STR:NPRED 68 STR:RPRED 100.0 SQ:SECSTR cEEEEEEEEETTTTEEEEEETTEEEEEEEGGGccccccccccTTcEEEEEEEEETcTTEEEEEEEEEc PSIPRED ccccEEEEEEccccEEEEEcccccEEEEEEEEcccccccccccccEEEEEEEEcccccccEEEEEEEc //