[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : AAS81977.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:115 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   1->109 PF04020 * DUF360 9.4e-28 50.9 106/108  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS81977.1 GT:GENE AAS81977.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION complement(1556109..1556456) GB:FROM 1556109 GB:TO 1556456 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAS81977.1 GB:DB_XREF GI:46197564 LENGTH 115 SQ:AASEQ MRNLFARLLLNTVALWFLTLLYPGVYFRAGAGLLDYLVAGAVWGLANALVRPVLLFLTLPLNLLTLGLFTLVVNGLVLFLVAAVTPLEVAGFGAALVGALVLSLVSLVLSWALKD GT:EXON 1|1-115:0| TM:NTM 4 TM:REGION 3->25| TM:REGION 33->55| TM:REGION 63->85| TM:REGION 91->113| SEG 48->84|alvrpvllfltlplnlltlglftlvvnglvlflvaav| SEG 87->113|levagfgaalvgalvlslvslvlswal| HM:PFM:NREP 1 HM:PFM:REP 1->109|PF04020|9.4e-28|50.9|106/108|DUF360| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2| PSIPRED cHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc //