[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : AAS81991.1
DDBJ      :             hypothetical conserved protein
Swiss-Prot:             

Homologs  Archaea  19/68 : Bacteria  104/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.58.5
:110 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   8->105 2dclC PDBj 4e-20 46.1 %
:RPS:PDB   4->105 2dclC PDBj 3e-26 44.1 %
:RPS:SCOP  9->105 1o51A  d.58.5.4 * 1e-24 46.4 %
:HMM:SCOP  5->106 1o51A_ d.58.5.4 * 1.6e-37 58.8 %
:RPS:PFM   9->104 PF02641 * DUF190 1e-28 60.4 %
:HMM:PFM   7->104 PF02641 * DUF190 1.4e-37 44.9 98/101  
:BLT:SWISS 2->110 Y7045_STRCO 2e-27 51.4 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS81991.1 GT:GENE AAS81991.1 GT:PRODUCT hypothetical conserved protein GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION 1566524..1566856 GB:FROM 1566524 GB:TO 1566856 GB:DIRECTION + GB:PRODUCT hypothetical conserved protein GB:PROTEIN_ID AAS81991.1 GB:DB_XREF GI:46197578 LENGTH 110 SQ:AASEQ MRLEGEALLLRVFLGESDRYEGRPLYEAIVLEARRRGLSGATVLKGFMGFGAHSRIHTAKILQLSEDLPVVVEIVDTEEKIQAFLPVLDGMVREGLVTLEKVRVLLYRSR GT:EXON 1|1-110:0| BL:SWS:NREP 1 BL:SWS:REP 2->110|Y7045_STRCO|2e-27|51.4|109/114| BL:PDB:NREP 1 BL:PDB:REP 8->105|2dclC|4e-20|46.1|89/97| RP:PDB:NREP 1 RP:PDB:REP 4->105|2dclC|3e-26|44.1|93/97| RP:PFM:NREP 1 RP:PFM:REP 9->104|PF02641|1e-28|60.4|96/101|DUF190| HM:PFM:NREP 1 HM:PFM:REP 7->104|PF02641|1.4e-37|44.9|98/101|DUF190| RP:SCP:NREP 1 RP:SCP:REP 9->105|1o51A|1e-24|46.4|84/89|d.58.5.4| HM:SCP:REP 5->106|1o51A_|1.6e-37|58.8|102/0|d.58.5.4|1/1|GlnB-like| OP:NHOMO 142 OP:NHOMOORG 123 OP:PATTERN -----------------------------------11-111111---1-122--1111111------- -12-1----------11----1--2------21---------1-------------------1---1-1-------------111111-------------------------------------11-1111111122222----1--------1-----------------------------2-11--------------------------------------------------------------------------------------------------------------------------------------------------------11-11---------1---------11----------3111-------1------1-211111111111-----------------------------------1-------------2------1---------------------------------1-----1---1------------1--------------------------------------------------11---11-11111-1111111411-11---------------------------11-----------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------------------------1-111-111-1- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 99 STR:RPRED 90.0 SQ:SECSTR ###cccEEEEEEEEETTcEETTEEHHHHHHHHHHHHTccccEEEEcccccccc########cccTTccEEEEEEEEEHHHHHHHHHHHGGGccccEEEEEEEcccccccc DISOP:02AL 1-4, 109-110| PSIPRED ccccccEEEEEEEEccccEEcccHHHHHHHHHHHHccccEEEEEEEEcccccccccccccEEEEcccccEEEEEEEcHHHHHHHHHHHHHHHccccEEEEEEEEEEEccc //