[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : AAS81999.1
DDBJ      :             putative ATP/GTP-binding integral membrane protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  50/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.18.1c.37.1
:352 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  158->347 1oe4A  c.18.1.3 * 6e-04 5.4 %
:HMM:SCOP  51->270 1l8qA2 c.37.1.20 * 1.8e-09 21.6 %
:HMM:PFM   43->350 PF03969 * AFG1_ATPase 5.1e-53 26.6 305/362  
:REPEAT 2|116->214|246->348
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS81999.1 GT:GENE AAS81999.1 GT:PRODUCT putative ATP/GTP-binding integral membrane protein GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION 1571298..1572356 GB:FROM 1571298 GB:TO 1572356 GB:DIRECTION + GB:PRODUCT putative ATP/GTP-binding integral membrane protein GB:PROTEIN_ID AAS81999.1 GB:DB_XREF GI:46197586 LENGTH 352 SQ:AASEQ MFRAPRAARPACGPFLCCGTQVRALSLRAMRLVERTPEVDLDRLLQGFVPPPRFLGATFQTYRPDPRYPSQALAKERLRRWVHDRPRGFLRPRLPGPQGIYLDGGFGVGKTHLLVAAYLEAPSPKAFLTFEELTYALGLLGLREGARRFSGLRYLFLDEFELDDPGNAQMVTHFLALTMDRGLRVATTSNTPPGALGEGRFNAEQFRHQIQSLARRFAVERIEGEDFRHRDPDRLPDPLPEERLLALYREDPRPKSLDDFPELIAHLRRLHPIRYRYLFDGLKAVYLRGLEPLHDQNDALRFVHFVDQLYNLGLDLKASGAPLKDLFPESYRHGAFAKKYGRALSRLAELLG GT:EXON 1|1-352:0| NREPEAT 1 REPEAT 2|116->214|246->348| SEG 3->11|rapraarpa| SEG 85->97|rprgflrprlpgp| SEG 136->148|algllglregarr| SEG 226->245|dfrhrdpdrlpdplpeerll| HM:PFM:NREP 1 HM:PFM:REP 43->350|PF03969|5.1e-53|26.6|305/362|AFG1_ATPase| RP:SCP:NREP 1 RP:SCP:REP 158->347|1oe4A|6e-04|5.4|185/245|c.18.1.3| HM:SCP:REP 51->270|1l8qA2|1.8e-09|21.6|185/213|c.37.1.20|1/1|P-loop containing nucleoside triphosphate hydrolases| OP:NHOMO 50 OP:NHOMOORG 50 OP:PATTERN -------------------------------------------------------------------- ----1---------11111-11--1111111111111111-11-111-1111111111------111111-----------------------------------------------------------------------------------------------------------------11111------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4, 90-92| PSIPRED ccccccccccccccEEEEcccccccccccHHHHHccccccHHHHHHccccHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHcccccccccccEEEEEccccccHHHHHHHHHHHccccccHHHHHHHHHHHHHHcHHHHHHHHHcccEEEEEEEEcccHHHHHHHHHHHHHHHHcccEEEEEccccHHHHccccccHHHHHHHHHHHHHHcEEEEcccccccccccccccccHHHHHHHHHHHHcccccEEccHHHHHHccccccHHHHHHHHccccEEEEccccccccHHHHHHHHHHHHHHHHccccEEEEcccHHHHHHHHHccccHHHHHHHHHHHHHHHHc //