[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : AAS82001.1
DDBJ      :             phosphopentomutase
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  381/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
c.76.1d.327.1
:381 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   6->371 2i09B PDBj 5e-67 44.2 %
:RPS:PDB   235->369 3e2dA PDBj 3e-11 8.9 %
:RPS:SCOP  2->118,235->380 2i09A1  c.76.1.5 * 7e-51 44.5 %
:RPS:SCOP  96->213 2i09A2  d.327.1.1 * 8e-27 46.3 %
:HMM:SCOP  1->381 2i09A1 c.76.1.5 * 6.9e-65 40.8 %
:RPS:PFM   4->371 PF01676 * Metalloenzyme 3e-14 32.3 %
:HMM:PFM   238->371 PF01676 * Metalloenzyme 3.1e-28 30.1 133/262  
:HMM:PFM   125->151 PF08415 * NRPS 0.00046 33.3 27/58  
:BLT:SWISS 1->379 DEOB_DEIRA e-123 58.6 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS82001.1 GT:GENE AAS82001.1 GT:PRODUCT phosphopentomutase GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION 1572620..1573765 GB:FROM 1572620 GB:TO 1573765 GB:DIRECTION + GB:PRODUCT phosphopentomutase GB:PROTEIN_ID AAS82001.1 GB:DB_XREF GI:46197588 LENGTH 381 SQ:AASEQ MKAVAIVLDSVGLGYLPDAPLFGDEGADTLDHTVLKTGIALPHLAGLGLGRVPGVHTLPRAERPRGGFGRMREVNPGKDTTTGHWEFVGIHLEKPFRTFPQGFPEDVLREWAEAIGVGGWLLNRPYSGTEAIRDYGEAHLKTGYPIVYTSADSVFQVAAHVDVVPVEELYRFCQVARERLVGELQVARVIARPFAGEPGRFYRLEHLRKDFALEPPRNVLDVLREGGLEVVGVGKIPDIYAGRGFTRKVKTKDNQDGLEKTLALMGEPFSGLVFTNLVDFDSKYGHRRDPEGYGRALVELDAFLPRLLAALGPEDHLFLVSDHGNDPTFFGTDHTREYAMLLWVGPGVEGELGTRETFADLGATWARLFGLAWDGPGTSLV GT:EXON 1|1-381:0| BL:SWS:NREP 1 BL:SWS:REP 1->379|DEOB_DEIRA|e-123|58.6|377/388| SEG 219->234|vldvlregglevvgvg| BL:PDB:NREP 1 BL:PDB:REP 6->371|2i09B|5e-67|44.2|344/381| RP:PDB:NREP 1 RP:PDB:REP 235->369|3e2dA|3e-11|8.9|135/502| RP:PFM:NREP 1 RP:PFM:REP 4->371|PF01676|3e-14|32.3|356/406|Metalloenzyme| HM:PFM:NREP 2 HM:PFM:REP 238->371|PF01676|3.1e-28|30.1|133/262|Metalloenzyme| HM:PFM:REP 125->151|PF08415|0.00046|33.3|27/58|NRPS| GO:PFM:NREP 2 GO:PFM GO:0003824|"GO:catalytic activity"|PF01676|IPR006124| GO:PFM GO:0046872|"GO:metal ion binding"|PF01676|IPR006124| RP:SCP:NREP 2 RP:SCP:REP 2->118,235->380|2i09A1|7e-51|44.5|258/283|c.76.1.5| RP:SCP:REP 96->213|2i09A2|8e-27|46.3|95/96|d.327.1.1| HM:SCP:REP 1->381|2i09A1|6.9e-65|40.8|265/0|c.76.1.5|1/1|Alkaline phosphatase-like| OP:NHOMO 433 OP:NHOMOORG 382 OP:PATTERN -------------------------------------------------------------------- --1------------------------------------------------------------------1--------1---1-------------------------------------------------------------1--------------------------------------11111111111111111111111111222211111111111111111111111111111111111111111-2-32-------22221-----1112221111111111111111111111111111111111111111111111-------1-1111111111111-11111111111111121111-11--------------1---------------------1111111111--111111111111-----1111111111-----------------------------------------------------------------------------------------------------------1--------------------1---------------1-1111---------------1-1111111-------111---11-111111111111111111111-------11-11121111112112222222-1222222222122222222111111111111111111111111222222211-211111111111---------1111--11----1----------------------------------------111111111-11121111111111----------------11----------------1------11-11--1111---11----1---11111--- -------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 357 STR:RPRED 93.7 SQ:SECSTR #####EEETTccccccTTGGGcEETTccHHHHHHHHTccccHHHHHHTGGGccccTTcccccccccEEEEEEcccccccHHHHHHHHTTccccccccccTTcccHHHHHHHHH############HHcccccTTTccccccccccEEEcccccEEEEEEcTTTccHHHHHHHHHHHHHcccTTccccEEEEEEccc#####ccccc#cEEEEccccccHHHHHHHTTccEEEETccHHHHHHHHHTccGGGccHHHHHHHHHHHccccccHHHHHHHHcEEEcTTccTTcTTTcccEEEcccccGGGcccccTHHHHHHHHHHHHTEEcccccEEcccEEEEEEccHHHGGGccEEEHHHHHHHHHHTcEEHHHHHHHHH# DISOP:02AL 381-382| PSIPRED cEEEEEEEccccccccccHHHHccccccHHHHHHHHcccccccHHHcccccccccccccccccHHHHHHHHHHHHcccccccHHHHHcccccccccccccccccHHHHHHHHHHHcccEEEEEEccccHHHHHHHHHHHHccccEEEEEccHHHEEEcccccEEcHHHHHHHHHHHHHHccccEEEEEEEEccccccccccEEEcccccccccccccHHHHHHHHcccEEEEEEEEEEEccccccccccccccHHHHHHHHHHHHHcccccEEEEEcccccccccccccHHHHHHHHHHHHHHHHHHHHHHccccEEEEEcccccccccccccccccccEEEEEcccccccccccccHHHHHHHHHHHccccccccccccc //