[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : AAS82023.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  1/68 : Bacteria  3/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:389 amino acids
:PSIPRED
:DISOPRED
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS82023.1 GT:GENE AAS82023.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION complement(1595877..1597046) GB:FROM 1595877 GB:TO 1597046 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAS82023.1 GB:DB_XREF GI:46197610 LENGTH 389 SQ:AASEQ MRHWYGALLAVGLLAACSQSPQGGVTPQVAVGPSVEVTKTAVPKFKRTYTWTIAKRVTDPSSGTLTLAPGQSYLVKYAVDLVGTPKDSVFRVEGTVTIKNTGSVDVVLQAPTDTLTPDGTSVPLACGVTFPYTLPAGQSLVCAYSQALPDGRSRTNTASVSWTGGSQSGTASGQASFAFTNPTEVVDGSVTVEDPSATLASAISGITPEGVISQTYFFERQVRFDACGEYEVQNTATFTTNTTQTQGSASATVKVTVPCQGGCTLTQGYWKTHSRYGPAPYDTTWAKVGEDTPFYLSGQSYYQVLWTSPSGGQAYYILAHQFIAARLNVLNGASTTPTVDAALAWADQFFQTYKPSDPLSKAVANQAKGYASTLDAYNNGLDGLVYCSE GT:EXON 1|1-389:0| SEG 6->16|gallavgllaa| SEG 163->176|tggsqsgtasgqas| SEG 233->252|qntatfttnttqtqgsasat| OP:NHOMO 5 OP:NHOMOORG 4 OP:PATTERN ----------------------------------------------------1--------------- ------------------------------------------------------------------------------------------------------------------------------------------------21----------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2| PSIPRED ccHHHHHHHHHHHHHHHccccccccccEEEEccccEEEEEEccccEEEEEEEEEEEEEccccEEEEEEccccEEEEEEEEEEEcccccEEEEEEEEEEEEcccEEEEEEccHHHccccccEEEEEEcEEEcEEcccccEEEEEEHHccccccccccEEEEEEcccccccccEEEEEEEEcccccEEEEEEEEEcHHHHHHHHHccccccEEEEEEEEEEEcccccccccEEEccEEEEEEEEEEccccccEEEEEEEEccccEEEEccHHHHcccccccccccHHHHccccccEEEEcccEEEEEEEcccccEEEEEEHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHcccccHHHHHHHHHHccHHHHHHHHcccccEEEEEcc //