[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : AAS82027.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:278 amino acids
:PSIPRED
:DISOPRED
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS82027.1 GT:GENE AAS82027.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION complement(1601561..1602397) GB:FROM 1601561 GB:TO 1602397 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAS82027.1 GB:DB_XREF GI:46197614 LENGTH 278 SQ:AASEQ MRKELFAVAALGLVPLALAQAPTVSPTQGNGPDAYAKGQDQAAVNQTVELILPKASALHLDVTTLTFDLTGLDGEGWPTSDPDFMGKMVCVYGRQDQDVKTQLGDNFYNQVQTLPLGTSYSVATWPNVTINGGGTVTAYPPIKLNQDGELVPGSKNYFVCYRTFILQKFSNGTQWDLTVTRNDPDQAQGIQHLYIQDNPCDTFGAATGLYELPNGATLHLVPRNLQAGPTGSRSGNNPERCGYKSWLDDLVVVAVKVNSDLWGKSTANLTYTLATTAW GT:EXON 1|1-278:0| SEG 5->22|lfavaalglvplalaqap| SEG 60->76|ldvttltfdltgldgeg| SEG 266->277|tanltytlatta| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3, 230-236| PSIPRED ccHHHHHHHHHHHHHHHHHcccccccccccHHHHHHcccccHHHccEEEEEEcccEEEEEEEEEEEEEEccccccccccccccccccEEEEEccccccccHHHHHHHHHHHHHccccccEEccccccEEEccccEEEEcccEEEccccccccccccEEEEEEEEEEEEccccccEEEEEEEccccHHHcEEEEEEccccccHHHHHHHHHHcccccEEEEEEccccccccEEEccccccccccccccccEEEEEEEEccccccEEEEEEEEEEEEccc //