[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : AAS82050.1
DDBJ      :             threonine dehydratase
Swiss-Prot:             

Homologs  Archaea  37/68 : Bacteria  671/915 : Eukaryota  179/199 : Viruses  0/175   --->[See Alignment]
c.79.1
:311 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   2->311 1ve5A PDBj e-131 92.2 %
:RPS:PDB   3->309 2d1fA PDBj 6e-34 19.5 %
:RPS:SCOP  1->310 1tdjA1  c.79.1.1 * 4e-42 31.1 %
:HMM:SCOP  4->311 1e5xA_ c.79.1.1 * 8.2e-85 43.6 %
:RPS:PFM   42->289 PF00291 * PALP 9e-15 37.3 %
:HMM:PFM   15->290 PF00291 * PALP 3.4e-76 44.4 266/297  
:BLT:SWISS 1->308 SRY1_YEAST 3e-47 41.9 %
:PROS 42->55|PS00165|DEHYDRATASE_SER_THR
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS82050.1 GT:GENE AAS82050.1 GT:PRODUCT threonine dehydratase GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION complement(1622499..1623434) GB:FROM 1622499 GB:TO 1623434 GB:DIRECTION - GB:PRODUCT threonine dehydratase GB:PROTEIN_ID AAS82050.1 GB:DB_XREF GI:46197637 LENGTH 311 SQ:AASEQ MPSLQDLYAAFRRIAPHTHRTPLLTSRLLDGLLGKRLLLKAEHLQKTGSFKARGALSKALALENPKGLLAVSSGNHAQGVAYAAQVLGVKALVVMPEDASPYKKACARAYGAEVVDRGVTAENREEVARALQEETGYALIHPFDDPLVIAGQGTAGLELLAQAGRMGVFPEAVLAPVGGGGLLAGLATAVKALSPTTLLLGVEPEVADDARRSLEAGRLFRLEAPPRTRADGVRTLSLGEHTFPILKEKADGILVVSEEAILEAERLLFTRTKQVVEPTGALPLAAVLEHGARLPQTLALLLSGGNRDFSP GT:EXON 1|1-311:0| BL:SWS:NREP 1 BL:SWS:REP 1->308|SRY1_YEAST|3e-47|41.9|303/326| PROS 42->55|PS00165|DEHYDRATASE_SER_THR|PDOC00149| SEG 23->40|lltsrlldgllgkrlllk| SEG 172->193|avlapvggggllaglatavkal| BL:PDB:NREP 1 BL:PDB:REP 2->311|1ve5A|e-131|92.2|308/308| RP:PDB:NREP 1 RP:PDB:REP 3->309|2d1fA|6e-34|19.5|302/349| RP:PFM:NREP 1 RP:PFM:REP 42->289|PF00291|9e-15|37.3|241/293|PALP| HM:PFM:NREP 1 HM:PFM:REP 15->290|PF00291|3.4e-76|44.4|266/297|PALP| GO:PFM:NREP 3 GO:PFM GO:0003824|"GO:catalytic activity"|PF00291|IPR001926| GO:PFM GO:0008152|"GO:metabolic process"|PF00291|IPR001926| GO:PFM GO:0030170|"GO:pyridoxal phosphate binding"|PF00291|IPR001926| RP:SCP:NREP 1 RP:SCP:REP 1->310|1tdjA1|4e-42|31.1|305/331|c.79.1.1| HM:SCP:REP 4->311|1e5xA_|8.2e-85|43.6|303/477|c.79.1.1|1/1|Tryptophan synthase beta subunit-like PLP-dependent enzymes| OP:NHOMO 1576 OP:NHOMOORG 887 OP:PATTERN 11--1111111111111211111-31122121---------------1------------11111-11 224-211122111121111-12111211111122221322111111--111111111111221-433131-1111111-------------1-1---11-1112111221--------------------------33344---111-11--11---11111111-1222-1111111111115211111-12122222222122222221111122122311--1111111112222222222222211111----11-----------1-1-1-1-1-------11111111111111-------------111111111--21-11111111111-111111111-1-1111122-11-1-2------114-12222-11-11132211112112111---1-1-3-11311313451-3332447334222322233313223441111111131111-22----------111122111111111-----21421355344555544333344444444343552323113331253353425411211112111111111122111---1---11-----11111111-111111-111111111111-1-------11-1111112211212111111111111111111111--11112------21111222222222222-2222222222222222222222321222222222222222222422222221-42222222222211-----------11332111111-111-111133433212211134434332142341222---------11111111111111122222221321111-11-11-----------------------1--------1------------11111-31 ----232----12222222222232322222224242211111122222233433211122221111121111111222211111111-24121111111112322-132G2422-1--1122162-2-181-1-111-2111111111-1112222-499428512212423612234F1135421133223253445 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 311 STR:RPRED 100.0 SQ:SECSTR HGGGccccccccccccccccccEEEcHHHHHHHccEEEEEEGGGcTTccTTHHHHHHHHHHHHTccEEEEccccHHHHHHHHHHHHTcEEEEEEccccccHHHHHHHHHTTcEEEEccccHHHHHHHHHHHHHHcTTEEEccTTcHHHHHHHTHHHHHHHHHHccccEEEccccHHHHHHHHHHHHHHHTTccccccEEEEEEEGGGcHHHcHHHHccccccccccccGGGcccccTTHHHHHHHHHHHTcEEEEEcHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHTccEEEEEEcccGGGcHc DISOP:02AL 311-312| PSIPRED cccHHHHHHHHHHHHHHcccccEEEcccccHHHccEEEEEEcccccccHHHHHHHHHHHHHcccccEEEEccccHHHHHHHHHHHHHcccEEEEEcccccHHHHHHHHHcccEEEEEcccHHHHHHHHHHHHHHcccEEccccccccHHHHHHHHHHHHHHHHHcccccccEEEEEcccHHHHHHHHHHHHHHccccEEEEEcccccHHHHHHHHcccEEEcccccccHHHHcccccccHHHHHHHHHcccEEEEEcHHHHHHHHHHHHHHcccEEccHHHHHHHHHHHHHHHcccEEEEEcccccccccc //