[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : AAS82064.1
DDBJ      :             multidrug resistance protein 2
Swiss-Prot:             

Homologs  Archaea  1/68 : Bacteria  43/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
f.38.1
:390 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  22->88 1pv6A  f.38.1.2 * 2e-08 27.7 %
:HMM:SCOP  1->389 1pv7A_ f.38.1.2 * 5.1e-50 35.5 %
:RPS:PFM   6->82 PF07690 * MFS_1 1e-04 46.8 %
:HMM:PFM   7->294 PF07690 * MFS_1 8.4e-38 34.6 272/353  
:HMM:PFM   215->386 PF07690 * MFS_1 1e-15 32.1 162/353  
:BLT:SWISS 6->136,318->368 BMR2_BACSU 3e-08 26.9 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS82064.1 GT:GENE AAS82064.1 GT:PRODUCT multidrug resistance protein 2 GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION complement(1638395..1639567) GB:FROM 1638395 GB:TO 1639567 GB:DIRECTION - GB:PRODUCT multidrug resistance protein 2 GB:PROTEIN_ID AAS82064.1 GB:DB_XREF GI:46197651 LENGTH 390 SQ:AASEQ MSPLALLFLTLFNSVLGLSILFPILGPLGRALGLTEVQVGLFSTGYALMQFLLSPYWGRRSERGRKPVLLVGILGFAASFLLFGVFALLGERGLVPPGLLFFLLLLARLLGGAFSSATLPTAQAYVADVTGRENRTAGMALLGAAFGLAVILGPALGAGLAALFGLLAPVFFSAGIALLNALFVYLVLPESRPRGQEAGARLSPFDPRVFPLLLLGLALNLSSVALEQTIAFYFQDRLLLGGVETAQKVGLALVLYGVVAVFVQGVLVRKTGWPPRVLLSLGLPLGILGFVLLVYAKTFWALALGLALQGAGQGLALPGVTAALSLAVGEGEQGLVAGLNSSAQALGRMLGPIVGTGLYRLAPEGPYVLGASLLLLALLFLPALFRRARL GT:EXON 1|1-390:0| BL:SWS:NREP 1 BL:SWS:REP 6->136,318->368|BMR2_BACSU|3e-08|26.9|169/400| TM:NTM 11 TM:REGION 5->27| TM:REGION 36->57| TM:REGION 68->90| TM:REGION 95->117| TM:REGION 139->161| TM:REGION 165->187| TM:REGION 206->228| TM:REGION 247->268| TM:REGION 282->304| TM:REGION 311->333| TM:REGION 364->385| SEG 92->113|rglvppgllffllllarllgga| SEG 137->171|agmallgaafglavilgpalgaglaalfgllapvf| SEG 212->226|llllglalnlssval| SEG 249->268|vglalvlygvvavfvqgvlv| SEG 278->289|llslglplgilg| SEG 301->317|alalglalqgagqglal| SEG 373->389|llllallflpalfrrar| RP:PFM:NREP 1 RP:PFM:REP 6->82|PF07690|1e-04|46.8|77/347|MFS_1| HM:PFM:NREP 2 HM:PFM:REP 7->294|PF07690|8.4e-38|34.6|272/353|MFS_1| HM:PFM:REP 215->386|PF07690|1e-15|32.1|162/353|MFS_1| GO:PFM:NREP 1 GO:PFM GO:0055085|"GO:transmembrane transport"|PF07690|IPR011701| RP:SCP:NREP 1 RP:SCP:REP 22->88|1pv6A|2e-08|27.7|65/417|f.38.1.2| HM:SCP:REP 1->389|1pv7A_|5.1e-50|35.5|377/417|f.38.1.2|1/1|MFS general substrate transporter| OP:NHOMO 52 OP:NHOMOORG 44 OP:PATTERN ------------------------------1------------------------------------- ------------------------------------------------------------1-------------------------------------------1---------------------1--111111----1----1--------------------------------------12111---------------------11-------111----------1----------------------------------------------------------------------------------------------------------------------------22---1---------------221----------------------------------------1-----------------11---1---------------------------------------------------11--------------------------------------------------------------------------1-----------------------11111------------------------1-------------1-----------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 191-203| PSIPRED cHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccc //