[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : AAS82068.1
DDBJ      :             phosphate-binding protein
Swiss-Prot:             

Homologs  Archaea  25/68 : Bacteria  372/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.94.1
:322 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   21->301 2capA PDBj 1e-50 13.7 %
:RPS:SCOP  20->299 1a40A  c.94.1.1 * 1e-51 20.4 %
:HMM:SCOP  19->293 1ixhA_ c.94.1.1 * 1.1e-75 38.4 %
:HMM:PFM   30->74 PF01547 * SBP_bac_1 8.2e-05 21.4 42/314  
:HMM:PFM   152->269 PF01547 * SBP_bac_1 0.00034 22.8 114/314  
:BLT:SWISS 21->312 SPHX_SYNY3 6e-86 51.9 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS82068.1 GT:GENE AAS82068.1 GT:PRODUCT phosphate-binding protein GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION complement(1642543..1643511) GB:FROM 1642543 GB:TO 1643511 GB:DIRECTION - GB:PRODUCT phosphate-binding protein GB:PROTEIN_ID AAS82068.1 GB:DB_XREF GI:46197655 LENGTH 322 SQ:AASEQ MRGKAWMLTAVALTGLGLAQIRADGSSTVYPITQAVAEEFTARNPNIRVVVAFSGTGGGFKKFCRGETDIQNASRPIRPEELEVCQENGIQFIELPVAYDALTVIVNPKNTWAACLKTSELKAIWEPGSKIQRWSQIRQGWPNQPLRLYGAGADSGTFDYFTEAIVGKAKAIRTDYQPTEDDNVTIKGVAGDTYAMGFLGYAYYEENKDKVKAVAIDHGKGCVLPSRETVLDGTYQPLSRPLFIYVNVKSLDRPEVQAFVDFYLSPAARRAIRSTGYVELPSEAYRIGQELVKRRKAGTFFMELPAGTPLSKFIQELDKELR GT:EXON 1|1-322:0| BL:SWS:NREP 1 BL:SWS:REP 21->312|SPHX_SYNY3|6e-86|51.9|291/336| SEG 8->19|ltavaltglgla| RP:PDB:NREP 1 RP:PDB:REP 21->301|2capA|1e-50|13.7|278/376| HM:PFM:NREP 2 HM:PFM:REP 30->74|PF01547|8.2e-05|21.4|42/314|SBP_bac_1| HM:PFM:REP 152->269|PF01547|0.00034|22.8|114/314|SBP_bac_1| RP:SCP:NREP 1 RP:SCP:REP 20->299|1a40A|1e-51|20.4|269/321|c.94.1.1| HM:SCP:REP 19->293|1ixhA_|1.1e-75|38.4|263/0|c.94.1.1|1/1|Periplasmic binding protein-like II| OP:NHOMO 524 OP:NHOMOORG 397 OP:PATTERN -----------------------11112-1121-2--221112-111221112--------------- ---------------------------------------1-212----------------112----------------1-1------1111-1--------1--11-1----------------221322233212222211121553233311221---111217323----------------11----1-111111111111111-1---11111111111--------111111111111111111111------1------------111----------1---------------1-------------111---1222-1-1-1121-2-1111-2222---11111111221-2----1121----1211111111---1---------11111111111---------1-11111111111111-1-111111111111-------------11211111---11---------------111-111-1---------------------------------------2----------2-3-111-1-------1121-2113111112111111---2-1-1111111-221----111111----------1-----111-12-1111-----111---11111121--12111--------1-------------------------------------11------------------------------11111111111---2---------21221---------------1111111---2222222122322223222---------122221111123222----------------2-111-11------------------------------------1111111111-11 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 300 STR:RPRED 93.2 SQ:SECSTR ###################EccEEEccTTHHHHTcTTTccTTccccHHHHHHHHTcGGGTcccTTccccEEEEcccccHHHHHHHHHHTccEEEEEEEEEEcccccccccccccEEcHHHHHHHHHTHTccccGGGcTTcccccccEEEEEccccHHHHHHHHHHHHHcccccccccccHHHHHHHHcTTccccEEccccHHHHcccGGGGGcTTTccEEcEEETTEEEcccccccccEEEEEEEEEcccccHHHHHHHHHHHcccccHHHHHHTTcccccHHHHHHHHHHHTcTTcTTcTcccccHHHHHHHHHHHHH### DISOP:02AL 174-183, 319-322| PSIPRED cHHHHHHHHHHHHHcccccEEEEEEHHHHHHHHHHHHHHHHHHccccEEEEEEcccHHHHHHHHcccccEEEccccccHHHHHHHHHccccEEEEEEEEEEEEEEEEccccccccccHHHHHHHHHHccccccccccccccccccEEEEEccccccHHHHHHHHHHccccccccccEEEccHHHHHHHHHHccccEEEEEHHHHHHccccEEEEEEccccccccccHHHHHccccccEEEEEEEEEEcccccHHHHHHHHHHHHcHHHHHHHHHcccccccHHHHHHHHHHHHcccccEEEccccccccHHHHHHHHHHHcc //