[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : AAS82077.1
DDBJ      :             50S ribosomal protein L33
Swiss-Prot:RL33_THET8   RecName: Full=50S ribosomal protein L33;

Homologs  Archaea  0/68 : Bacteria  258/915 : Eukaryota  7/199 : Viruses  0/175   --->[See Alignment]
g.41.8
:54 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   6->54 2hgu5 PDBj 3e-27 100.0 %
:RPS:PDB   5->53 3bbo3 PDBj 2e-11 61.2 %
:RPS:SCOP  11->53 2hgj51  g.41.8.6 * 6e-14 100.0 %
:HMM:SCOP  2->53 2gya11 g.41.8.6 * 5.8e-19 61.5 %
:RPS:PFM   6->53 PF00471 * Ribosomal_L33 2e-10 66.7 %
:HMM:PFM   6->53 PF00471 * Ribosomal_L33 1.7e-26 68.8 48/48  
:BLT:SWISS 1->54 RL33_THET8 8e-30 100.0 %
:PROS 21->40|PS00582|RIBOSOMAL_L33

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS82077.1 GT:GENE AAS82077.1 GT:PRODUCT 50S ribosomal protein L33 GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION 1651178..1651342 GB:FROM 1651178 GB:TO 1651342 GB:DIRECTION + GB:PRODUCT 50S ribosomal protein L33 GB:PROTEIN_ID AAS82077.1 GB:DB_XREF GI:46197665 LENGTH 54 SQ:AASEQ MASEVRIKLLLECTECKRRNYATEKNKRNTPNKLELRKYCPWCRKHTVHREVKI GT:EXON 1|1-54:0| SW:ID RL33_THET8 SW:DE RecName: Full=50S ribosomal protein L33; SW:GN Name=rpmG; Synonyms=rpl33; OrderedLocusNames=TTHA0250; SW:KW 3D-structure; Complete proteome; Direct protein sequencing;Ribonucleoprotein; Ribosomal protein; RNA-binding; rRNA-binding;tRNA-binding. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->54|RL33_THET8|8e-30|100.0|54/54| GO:SWS:NREP 5 GO:SWS GO:0030529|"GO:ribonucleoprotein complex"|Ribonucleoprotein| GO:SWS GO:0005840|"GO:ribosome"|Ribosomal protein| GO:SWS GO:0003723|"GO:RNA binding"|RNA-binding| GO:SWS GO:0019843|"GO:rRNA binding"|rRNA-binding| GO:SWS GO:0000049|"GO:tRNA binding"|tRNA-binding| PROS 21->40|PS00582|RIBOSOMAL_L33|PDOC00503| BL:PDB:NREP 1 BL:PDB:REP 6->54|2hgu5|3e-27|100.0|49/49| RP:PDB:NREP 1 RP:PDB:REP 5->53|3bbo3|2e-11|61.2|49/65| RP:PFM:NREP 1 RP:PFM:REP 6->53|PF00471|2e-10|66.7|48/48|Ribosomal_L33| HM:PFM:NREP 1 HM:PFM:REP 6->53|PF00471|1.7e-26|68.8|48/48|Ribosomal_L33| GO:PFM:NREP 4 GO:PFM GO:0003735|"GO:structural constituent of ribosome"|PF00471|IPR001705| GO:PFM GO:0005622|"GO:intracellular"|PF00471|IPR001705| GO:PFM GO:0005840|"GO:ribosome"|PF00471|IPR001705| GO:PFM GO:0006412|"GO:translation"|PF00471|IPR001705| RP:SCP:NREP 1 RP:SCP:REP 11->53|2hgj51|6e-14|100.0|43/45|g.41.8.6| HM:SCP:REP 2->53|2gya11|5.8e-19|61.5|52/0|g.41.8.6|1/1|Zn-binding ribosomal proteins| OP:NHOMO 310 OP:NHOMOORG 265 OP:PATTERN -------------------------------------------------------------------- ---11---------11111-1111111111111111111111111111------------1111111111111111111111111---------------1----1----------------------------1------111-1-11-111--11------11--------1------------1111-1322222222-2222221112221--211112111111-122-22222222222222122221111--11111--11--111---1111-------1-------------------------------111-1-1111111111-111111-1111-111111111111---111-1111111-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--1--111111----11-111----1-1-1----11111111111111---11---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11------111-11-11-2111---11--1----------1--1----1111-1--- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--1111----1-4---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 53 STR:RPRED 98.1 SQ:SECSTR #ccccccccEEccccTTccccccEEccTTccccccccccccccccccccccccc DISOP:02AL 1-3| PSIPRED cccccEEEEEEEEcccccEEEEEEccccccccEEEEEccccccccEEEEEEEEc //