[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : AAS82080.1
DDBJ      :             LSU ribosomal protein L11P
Swiss-Prot:RL11_THETH   RecName: Full=50S ribosomal protein L11;

Homologs  Archaea  59/68 : Bacteria  911/915 : Eukaryota  168/199 : Viruses  0/175   --->[See Alignment]
a.4.7d.47.1
:147 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->147 3f1fK PDBj 4e-81 100.0 %
:RPS:PDB   2->138 3bboK PDBj 9e-48 58.4 %
:RPS:SCOP  8->68 1mmsA2  d.47.1.1 * 4e-21 73.8 %
:RPS:SCOP  66->138 1hc8A  a.4.7.1 * 9e-27 58.9 %
:HMM:SCOP  2->83 1wibA_ d.47.1.1 * 2.1e-27 55.0 %
:HMM:SCOP  66->139 1hc8A_ a.4.7.1 * 8.5e-29 67.6 %
:RPS:PFM   8->65 PF03946 * Ribosomal_L11_N 9e-13 65.5 %
:RPS:PFM   70->138 PF00298 * Ribosomal_L11 2e-17 66.7 %
:HMM:PFM   70->138 PF00298 * Ribosomal_L11 3.6e-35 66.7 69/69  
:HMM:PFM   7->65 PF03946 * Ribosomal_L11_N 6.5e-31 64.4 59/60  
:BLT:SWISS 1->147 RL11_THETH 1e-80 100.0 %
:PROS 125->140|PS00359|RIBOSOMAL_L11

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS82080.1 GT:GENE AAS82080.1 GT:PRODUCT LSU ribosomal protein L11P GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION 1652119..1652562 GB:FROM 1652119 GB:TO 1652562 GB:DIRECTION + GB:PRODUCT LSU ribosomal protein L11P GB:PROTEIN_ID AAS82080.1 GB:DB_XREF GI:46197668 LENGTH 147 SQ:AASEQ MKKVVAVVKLQLPAGKATPAPPVGPALGQHGANIMEFVKAFNAATANMGDAIVPVEITIYADRSFTFVTKTPPASYLIRKAAGLEKGAHKPGREKVGRITWEQVLEIAKQKMPDLNTTDLEAAARMIAGSARSMGVEVVGAPEVKDA GT:EXON 1|1-147:0| SW:ID RL11_THETH SW:DE RecName: Full=50S ribosomal protein L11; SW:GN Name=rplK; Synonyms=rpl11; SW:KW 3D-structure; Methylation; Ribonucleoprotein; Ribosomal protein;RNA-binding; rRNA-binding. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->147|RL11_THETH|1e-80|100.0|147/147| GO:SWS:NREP 4 GO:SWS GO:0030529|"GO:ribonucleoprotein complex"|Ribonucleoprotein| GO:SWS GO:0005840|"GO:ribosome"|Ribosomal protein| GO:SWS GO:0003723|"GO:RNA binding"|RNA-binding| GO:SWS GO:0019843|"GO:rRNA binding"|rRNA-binding| PROS 125->140|PS00359|RIBOSOMAL_L11|PDOC00310| BL:PDB:NREP 1 BL:PDB:REP 1->147|3f1fK|4e-81|100.0|147/147| RP:PDB:NREP 1 RP:PDB:REP 2->138|3bboK|9e-48|58.4|137/145| RP:PFM:NREP 2 RP:PFM:REP 8->65|PF03946|9e-13|65.5|58/60|Ribosomal_L11_N| RP:PFM:REP 70->138|PF00298|2e-17|66.7|69/69|Ribosomal_L11| HM:PFM:NREP 2 HM:PFM:REP 70->138|PF00298|3.6e-35|66.7|69/69|Ribosomal_L11| HM:PFM:REP 7->65|PF03946|6.5e-31|64.4|59/60|Ribosomal_L11_N| GO:PFM:NREP 6 GO:PFM GO:0003735|"GO:structural constituent of ribosome"|PF03946|IPR000911| GO:PFM GO:0005840|"GO:ribosome"|PF03946|IPR000911| GO:PFM GO:0006412|"GO:translation"|PF03946|IPR000911| GO:PFM GO:0003735|"GO:structural constituent of ribosome"|PF00298|IPR000911| GO:PFM GO:0005840|"GO:ribosome"|PF00298|IPR000911| GO:PFM GO:0006412|"GO:translation"|PF00298|IPR000911| RP:SCP:NREP 2 RP:SCP:REP 8->68|1mmsA2|4e-21|73.8|61/63|d.47.1.1| RP:SCP:REP 66->138|1hc8A|9e-27|58.9|73/74|a.4.7.1| HM:SCP:REP 2->83|1wibA_|2.1e-27|55.0|80/0|d.47.1.1|1/1|Ribosomal L11/L12e N-terminal domain| HM:SCP:REP 66->139|1hc8A_|8.5e-29|67.6|74/0|a.4.7.1|1/1|Ribosomal protein L11, C-terminal domain| OP:NHOMO 1209 OP:NHOMOORG 1138 OP:PATTERN --111111111111111-1---111111111-1111111111111111111111111111111-11-1 1111111111111111111-1111111111111111111111211111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111131111111111211111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111211111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111111111111 11------312-111111111111111111111111-1-1-111111111111111111111111111111111111-1111111111-11111111111111112--3-1111-1-1-1-11-12-21453-212111-111111-11-11111--1111-1111-111-11112222N222124224-321131112 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 147 STR:RPRED 100.0 SQ:SECSTR ccccccEEEEcccTTcccccTTTTTTTTTTcccTTccHHHHHHHGGGcccccccEEEEEcccccEEEEEccccTTHHHHHHHTcccccccTTTcccEEEcHHHHHHHHHHTcTTcccccHHHHHHHHHHHHTTTTEEEccccTTccc DISOP:02AL 82-95, 146-147| PSIPRED cccEEEEEEEEEEcccccccccccHHHccccccHHHHHHHHHHHHHHHcccEEEEEEEEEcccEEEEEEccccHHHHHHHHHccccccccccccEEEEccHHHHHHHHHHHHHHHccccHHHHHHHHHHccEEccEEEccccccccc //