[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : AAS82081.1
DDBJ      :             LSU ribosomal protein L1P
Swiss-Prot:RL1_THETH    RecName: Full=50S ribosomal protein L1;

Homologs  Archaea  4/68 : Bacteria  907/915 : Eukaryota  35/199 : Viruses  0/175   --->[See Alignment]
e.24.1
:229 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   2->229 2hguC PDBj e-112 100.0 %
:RPS:PDB   6->229 1ad2A PDBj 1e-63 87.1 %
:RPS:SCOP  6->229 1ad2A  e.24.1.1 * 6e-64 87.1 %
:HMM:SCOP  6->229 1ad2A_ e.24.1.1 * 1.4e-82 54.5 %
:RPS:PFM   19->222 PF00687 * Ribosomal_L1 3e-37 46.0 %
:HMM:PFM   15->222 PF00687 * Ribosomal_L1 9.4e-85 56.0 207/209  
:BLT:SWISS 1->229 RL1_THETH e-112 100.0 %
:PROS 1->47|PS00430|TONB_DEPENDENT_REC_1
:PROS 121->140|PS01199|RIBOSOMAL_L1
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS82081.1 GT:GENE AAS82081.1 GT:PRODUCT LSU ribosomal protein L1P GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION 1652555..1653244 GB:FROM 1652555 GB:TO 1653244 GB:DIRECTION + GB:PRODUCT LSU ribosomal protein L1P GB:PROTEIN_ID AAS82081.1 GB:DB_XREF GI:46197669 LENGTH 229 SQ:AASEQ MPKHGKRYRALLEKVDPNKIYTIDEAAHLVKELATAKFDETVEVHAKLGIDPRRSDQNVRGTVSLPHGLGKQVRVLAIAKGEKIKEAEEAGADYVGGEEIIQKILDGWMDFDAVVATPDVMGAVGSKLGRILGPRGLLPNPKAGTVGFNIGEIIREIKAGRIEFRNDKTGAIHAPVGKASFPPEKLADNIRAFIRALEAHKPEGAKGTFLRSVYVTTTMGPSVRINPHS GT:EXON 1|1-229:0| SW:ID RL1_THETH SW:DE RecName: Full=50S ribosomal protein L1; SW:GN Name=rplA; Synonyms=rpl1; SW:KW 3D-structure; Direct protein sequencing; Repressor; Ribonucleoprotein;Ribosomal protein; RNA-binding; rRNA-binding; Translation regulation;tRNA-binding. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->229|RL1_THETH|e-112|100.0|229/229| GO:SWS:NREP 6 GO:SWS GO:0030529|"GO:ribonucleoprotein complex"|Ribonucleoprotein| GO:SWS GO:0005840|"GO:ribosome"|Ribosomal protein| GO:SWS GO:0003723|"GO:RNA binding"|RNA-binding| GO:SWS GO:0019843|"GO:rRNA binding"|rRNA-binding| GO:SWS GO:0006417|"GO:regulation of translation"|Translation regulation| GO:SWS GO:0000049|"GO:tRNA binding"|tRNA-binding| PROS 1->47|PS00430|TONB_DEPENDENT_REC_1|PDOC00354| PROS 121->140|PS01199|RIBOSOMAL_L1|PDOC00922| SEG 77->92|aiakgekikeaeeaga| SEG 128->139|lgrilgprgllp| BL:PDB:NREP 1 BL:PDB:REP 2->229|2hguC|e-112|100.0|228/228| RP:PDB:NREP 1 RP:PDB:REP 6->229|1ad2A|1e-63|87.1|224/224| RP:PFM:NREP 1 RP:PFM:REP 19->222|PF00687|3e-37|46.0|200/206|Ribosomal_L1| HM:PFM:NREP 1 HM:PFM:REP 15->222|PF00687|9.4e-85|56.0|207/209|Ribosomal_L1| GO:PFM:NREP 2 GO:PFM GO:0003723|"GO:RNA binding"|PF00687|IPR002143| GO:PFM GO:0006396|"GO:RNA processing"|PF00687|IPR002143| RP:SCP:NREP 1 RP:SCP:REP 6->229|1ad2A|6e-64|87.1|224/224|e.24.1.1| HM:SCP:REP 6->229|1ad2A_|1.4e-82|54.5|224/224|e.24.1.1|1/1|Ribosomal protein L1| OP:NHOMO 995 OP:NHOMOORG 946 OP:PATTERN -------------------------------------------------1-------1-11------- 1111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-111111111111111111111111111111111121111111111111111111111111111--111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-1111111111111111111111111-11-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111111111111 ------1---------------------------11-11111--------------1-----1---------------------------1------------1-1--4------------------------------------------------------------------2222Q1-2223234-32112111- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 229 STR:RPRED 100.0 SQ:SECSTR ccccccccTTTTTcccTTccccHHHHHHHHHTTcccccccEEEEEEEEcccTTcGGGccEEEEEccccccTTccEEEEccTHHHHHHHHTTccEEEcGGGHHHHHTTcccccEEEEcGGGHHHHHHHHHHHHHHHTccccTTTTcccccHHHHHHHHHTTEEEEEccTTcEEEEEEEETTccHHHHHHHHHHHHHHHHTTccTTcccccEEEEEEEcTTcccEEEcTTc DISOP:02AL 1-4, 8-10, 227-229| PSIPRED cccHHHHHHHHHHHccccccccHHHHHHHHHHccccccccEEEEEEEEEccccccccEEEEEEEccccccccEEEEEEccHHHHHHHHHcccccccHHHHHHHHHHHHHcccEEEEcHHHHHHHHHHHcccccccccccccccccccccHHHHHHHHHccEEEEEEccccEEEEEEEEccccHHHHHHHHHHHHHHHHHHccccccccEEEEEEEEEcccccEEEcccc //