[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : AAS82089.1
DDBJ      :             lipoic acid synthetase
Swiss-Prot:LIPA_THET8   RecName: Full=Lipoyl synthase;         EC=2.8.1.8;AltName: Full=Lipoic acid synthase;AltName: Full=Lipoate synthase;AltName: Full=Sulfur insertion protein lipA;AltName: Full=Lip-syn;         Short=LS;

Homologs  Archaea  20/68 : Bacteria  701/915 : Eukaryota  186/199 : Viruses  0/175   --->[See Alignment]
c.1.28c.92.1
:323 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   36->314 3cixA PDBj 3e-30 13.0 %
:RPS:SCOP  74->301 1qgoA  c.92.1.2 * 5e-21 10.2 %
:HMM:SCOP  48->314 1r30A_ c.1.28.1 * 6.9e-66 35.9 %
:HMM:PFM   92->253 PF04055 * Radical_SAM 1.5e-17 20.5 156/166  
:BLT:SWISS 1->323 LIPA_THET8 e-179 100.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS82089.1 GT:GENE AAS82089.1 GT:PRODUCT lipoic acid synthetase GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION 1658320..1659291 GB:FROM 1658320 GB:TO 1659291 GB:DIRECTION + GB:PRODUCT lipoic acid synthetase GB:PROTEIN_ID AAS82089.1 GB:DB_XREF GI:46197677 LENGTH 323 SQ:AASEQ MKPKFETVELLSPTGEVVELKVVKRGLAQARPEPVDRNKPAWIKAPLPTGPRYQALKAMVRELRLHTVCQEALCPNIGECWTHGTLTVMILGDICTRACKFCAVHTGNPKGLVDPEEPRRVAEAIARMGVRYVVLTSVDRDDLPDGGASHFAATIRAIKERAPGVLVEALTPDFQGDLKAVETVLAANPEVYAQNLETVRRLTPKVRDPRAGYEQTLKVLAHAKKVRPDILTKSSLMLGLGETEEEILEAMRDLRAAGVDILTLGQYLRPTPAHLPVARYVPPEDFKRYEAWGYELGFREVFAGPLVRSSYRADRVFLEATQR GT:EXON 1|1-323:0| SW:ID LIPA_THET8 SW:DE RecName: Full=Lipoyl synthase; EC=2.8.1.8;AltName: Full=Lipoic acid synthase;AltName: Full=Lipoate synthase;AltName: Full=Sulfur insertion protein lipA;AltName: Full=Lip-syn; Short=LS; SW:GN Name=lipA; OrderedLocusNames=TTHA0239; SW:KW 4Fe-4S; Complete proteome; Cytoplasm; Iron; Iron-sulfur;Metal-binding; S-adenosyl-L-methionine; Transferase. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->323|LIPA_THET8|e-179|100.0|323/323| GO:SWS:NREP 5 GO:SWS GO:0051539|"GO:4 iron, 4 sulfur cluster binding"|4Fe-4S| GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0051536|"GO:iron-sulfur cluster binding"|Iron-sulfur| GO:SWS GO:0046872|"GO:metal ion binding"|Metal-binding| GO:SWS GO:0016740|"GO:transferase activity"|Transferase| SEG 236->249|lmlglgeteeeile| RP:PDB:NREP 1 RP:PDB:REP 36->314|3cixA|3e-30|13.0|270/345| HM:PFM:NREP 1 HM:PFM:REP 92->253|PF04055|1.5e-17|20.5|156/166|Radical_SAM| RP:SCP:NREP 1 RP:SCP:REP 74->301|1qgoA|5e-21|10.2|215/257|c.92.1.2| HM:SCP:REP 48->314|1r30A_|6.9e-66|35.9|259/312|c.1.28.1|1/1|Radical SAM enzymes| OP:NHOMO 1075 OP:NHOMOORG 907 OP:PATTERN 11-----11111111---111---1111--11-----------------------------1------ 1121111111111111111-111111111111211111221112111111112221111111111111111-----------11-1111111-111-111111111111111111111111111111111111111111-1---21222222232222222222222222222222222222211111--11111111111111111111111111111111111------1111111111111111111111----------------------------------------------------------------------11---------------11--------11-------1-----111111--111111111111112111111111111111111111-11211111111111111121111111111111111111111111111111111111111111111111111111111111111111111111111222222111112222111111222111111111121111111111111111111111111111111--1-1--11-2111-111111112111111-11---------------------111111111111111111111111111111111111-1111111111111111111111111111-11211111111111111111111111111111111111111111111111111111111111111--11111111111111111111111111111112222212111111111111111211111111111111111111111111111111111111111111111-111111--------1-------------------------------------111 11----1-311-1111111-111111111111111111111111111111111111111111111111-1111111111111111111-12111111111111112-1512121111111111121121382-31311111-12-1111111111211112111211111A11222222R2222223351222211113 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 300 STR:RPRED 92.9 SQ:SECSTR ##################HHHTcTTccccccHHHHHHHHHHHHHTTcccHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHccEEEEEEEEEEcccccccTTcTTcTTcccccccHHHHHHHHHHHHHTTccEEEEEEcccGGGTTcccHHHHHHHHHHHTTccEEEEEcccccHcccHHHHHHHHHTTccEEEcccccccHHHHHHHcTTccHHHHHHHHHHHHTTcEEEEEEccEEccTTccHHHHHHHHHHHHHHTccEEccEEccccTTcTTTTcccccHHHHHHHHHHHHHHcTTccccccHHHHHHcTTHHHH##### DISOP:02AL 1-5, 8-41| PSIPRED ccccccccccccccccccccccccccccccccccccccccHHHEEEccccccHHHHHHHHHHccccEEEcccccccHHHHccccEEEEEEEcccccccccccccccccccccccHHHHHHHHHHHHHHcccEEEEEcccccccccccHHHHHHHHHHHHHHccccEEEEEcccccccHHHHHHHHHccccEEEcccHHHHHHccccccccccHHHHHHHHHHHHHHccccEEEccEEEcccccHHHHHHHHHHHHHccccEEEccccccccHHccccEEcccHHHHHHHHHHHHHccHHHEEEccccHHHHHHHHHHHHHHcc //