[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : AAS82098.1
DDBJ      :             2-oxoisovalerate dehydrogenase beta subunit
Swiss-Prot:ODBB_THET2   RecName: Full=2-oxoisovalerate dehydrogenase subunit beta;         EC=1.2.4.4;AltName: Full=Branched-chain alpha-keto acid dehydrogenase E1 component beta chain;         Short=BCKDH E1-beta;

Homologs  Archaea  35/68 : Bacteria  618/915 : Eukaryota  192/199 : Viruses  0/175   --->[See Alignment]
c.36.1c.48.1
:324 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   2->324 1umdB PDBj e-166 99.4 %
:RPS:PDB   4->324 2bfcB PDBj 1e-63 43.4 %
:RPS:SCOP  1->187 1dtwB1  c.36.1.7 * 1e-45 48.9 %
:RPS:SCOP  183->322 1ay0A3  c.48.1.1 * 1e-27 15.0 %
:HMM:SCOP  1->204 1qs0B1 c.36.1.7 * 1.6e-78 59.1 %
:HMM:SCOP  188->324 1umdB2 c.48.1.2 * 7.4e-41 43.8 %
:RPS:PFM   13->179 PF02779 * Transket_pyr 7e-18 36.2 %
:RPS:PFM   196->306 PF02780 * Transketolase_C 3e-17 43.2 %
:HMM:PFM   4->178 PF02779 * Transket_pyr 2.1e-60 42.1 171/178  
:HMM:PFM   194->306 PF02780 * Transketolase_C 2e-36 50.4 113/124  
:BLT:SWISS 1->324 ODBB_THET2 e-168 100.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS82098.1 GT:GENE AAS82098.1 GT:PRODUCT 2-oxoisovalerate dehydrogenase beta subunit GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION complement(1666048..1667022) GB:FROM 1666048 GB:TO 1667022 GB:DIRECTION - GB:PRODUCT 2-oxoisovalerate dehydrogenase beta subunit GB:PROTEIN_ID AAS82098.1 GB:DB_XREF GI:46197686 LENGTH 324 SQ:AASEQ MALMTMVQALNRALDEEMAKDPRVVVLGEDVGKRGGVFLVTEGLLQKYGPDRVMDTPLSEAAIVGAALGMAAHGLRPVAEIQFADYIFPGFDQLVSQVAKLRYRSGGQFTAPLVVRMPSGGGVRGGHHHSQSPEAHFVHTAGLKVVAVSTPYDAKGLLKAAIRDEDPVVFLEPKRLYRSVKEEVPEEDYTLSIGKAALRREGKDLTLIGYGTVMPEVLQAAAELAKAGVSAEVLDLRTLMPWDYEAVMNSVAKTGRVVLVSDAPRHASFVSEVAATIAEDLLDMLLAPPIRVTGFDTPYPYAQDKLYLPTVTRILNAAKRALDY GT:EXON 1|1-324:0| SW:ID ODBB_THET2 SW:DE RecName: Full=2-oxoisovalerate dehydrogenase subunit beta; EC=1.2.4.4;AltName: Full=Branched-chain alpha-keto acid dehydrogenase E1 component beta chain; Short=BCKDH E1-beta; SW:GN OrderedLocusNames=TT_C1756; SW:KW Complete proteome; Oxidoreductase; Thiamine pyrophosphate. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->324|ODBB_THET2|e-168|100.0|324/324| GO:SWS:NREP 2 GO:SWS GO:0016491|"GO:oxidoreductase activity"|Oxidoreductase| GO:SWS GO:0055114|"GO:oxidation reduction"|Oxidoreductase| SEG 61->72|aaivgaalgmaa| SEG 120->129|gggvrgghhh| BL:PDB:NREP 1 BL:PDB:REP 2->324|1umdB|e-166|99.4|323/323| RP:PDB:NREP 1 RP:PDB:REP 4->324|2bfcB|1e-63|43.4|320/332| RP:PFM:NREP 2 RP:PFM:REP 13->179|PF02779|7e-18|36.2|160/172|Transket_pyr| RP:PFM:REP 196->306|PF02780|3e-17|43.2|111/122|Transketolase_C| HM:PFM:NREP 2 HM:PFM:REP 4->178|PF02779|2.1e-60|42.1|171/178|Transket_pyr| HM:PFM:REP 194->306|PF02780|2e-36|50.4|113/124|Transketolase_C| GO:PFM:NREP 2 GO:PFM GO:0003824|"GO:catalytic activity"|PF02780|IPR005476| GO:PFM GO:0008152|"GO:metabolic process"|PF02780|IPR005476| RP:SCP:NREP 2 RP:SCP:REP 1->187|1dtwB1|1e-45|48.9|186/188|c.36.1.7| RP:SCP:REP 183->322|1ay0A3|1e-27|15.0|140/146|c.48.1.1| HM:SCP:REP 1->204|1qs0B1|1.6e-78|59.1|203/204|c.36.1.7|1/1|Thiamin diphosphate-binding fold (THDP-binding)| HM:SCP:REP 188->324|1umdB2|7.4e-41|43.8|137/137|c.48.1.2|1/1|TK C-terminal domain-like| OP:NHOMO 1701 OP:NHOMOORG 845 OP:PATTERN 11----213323323--1111---2111-111---111-111------------11--1-2221---- 11314-------1-22211-1---32111111333324643324122211114352241144312272322--------1115---111111-1--21143335444234222222222222221---------2-45522---2312212211111211212111411211211211311112212211-423333333332333333353343333365233222232242122222222222222233322-1-22-1--1111111111111111111111112211111-111111111111111111211111111111--11111111-1-12111--------2-1-1111----1--22213-231-411211222333223112212144443343343-11111211241122223374225423212336232233422222222133112131111111111--11111111111111111-25C31-1-113222321111111141111-32122221--111-1-----2421--11----1----------121112-3----12----424224423111122-3----------------------1112211-11-221122211122111112111123---21--------------1-----------------------------1122--12------------------------------------------2333222222--2-1---1-----------11111-1---3-3333121112222-1---------------1-----11-112211111222-------1112222----------111111-1-11111111111111----1------1-121 22--223-622-22222222222222222222222222222222222223223222222222211111111111111-1111111111-22222222222211222126242422212222222431318K3-4352222222332222222242333424523223621F32223342U2223355A62563442223 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 324 STR:RPRED 100.0 SQ:SECSTR HHHEcHHHHHHHHHHHHHHHcTTcEEEETTTTcTTcTTcTTTTHHHHHcTTTEEEccccHHHHHHHHHHHHHTTccEEEEcccGGGcGGGHHHHHTTGGGHHHHTTTccccTTEEEEEEccccccHHHHcccTHHHHHTcTTcEEEccccHHHHHHHHHHHHHccccEEEEEEGGGTTcccEEEEcccccccTTccEEEEccccEEEEEcTTHHHHHHHHHHHHHHHcccEEEEEccEEEcccHHHHHHHHHHHccEEEEEEEEcTTcHHHHHHHHHHHHHGGGcccccEEEEEcccccccTTHHHHcccHHHHHHHHHHHHTc PSIPRED ccccHHHHHHHHHHHHHHHHcccEEEEEcHHcccccEEEccHHHHHHHccccEEEccccHHHHHHHHHHHHHccccEEEEEEHHHHHHHHHHHHHHHHHHHHHHccccccccEEEEEcccccccccccccHHHHHHHHHHcccEEEEEccHHHHHHHHHHHHHccccEEEEEEccccccccccccccccEEccccEEEEEccccEEEEEccHHHHHHHHHHHHHHHccccEEEEEHHHcccccHHHHHHHHHHcccEEEEEcccccccHHHHHHHHHHHHHHHHccccEEEEEccccccccHHHHHHcccHHHHHHHHHHHHcc //