[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : AAS82116.1
DDBJ      :             hypothetical conserved protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  10/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
b.52.1
:143 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   27->138 2ae0X PDBj 3e-12 18.1 %
:RPS:SCOP  24->136 2ae0X1  b.52.1.4 * 3e-08 17.0 %
:BLT:SWISS 27->139 YABE_BACSU 7e-06 33.3 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS82116.1 GT:GENE AAS82116.1 GT:PRODUCT hypothetical conserved protein GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION 1681161..1681592 GB:FROM 1681161 GB:TO 1681592 GB:DIRECTION + GB:PRODUCT hypothetical conserved protein GB:PROTEIN_ID AAS82116.1 GB:DB_XREF GI:46197704 LENGTH 143 SQ:AASEQ MRGLLLAISLLAVPWPQALAQSAGKPKVLILEATAYTSSVRETDSTPHITATGARTRLGILAVSRDLLEILPFGTKVRLKDLGTIYGRGKGQFDALFKDIVFVVADVMNARWRKKVDIWFPDRATALRFGRRKVQLEVVAYPE GT:EXON 1|1-143:0| BL:SWS:NREP 1 BL:SWS:REP 27->139|YABE_BACSU|7e-06|33.3|90/100| RP:PDB:NREP 1 RP:PDB:REP 27->138|2ae0X|3e-12|18.1|105/335| RP:SCP:NREP 1 RP:SCP:REP 24->136|2ae0X1|3e-08|17.0|106/335|b.52.1.4| OP:NHOMO 10 OP:NHOMOORG 10 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11111-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111----------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 105 STR:RPRED 73.4 SQ:SECSTR ##########################HHHHTTccccEE#EEEEcccccccTTcccccTTEEEccT###TTccTTcEEEEE###EEEEcTTccEEEEEEEEEEEEEEccTTccTTcEEEEEEEcHHHHccccEEEEEEE##### DISOP:02AL 1-2, 14-29| PSIPRED cccEEEEEEEEEccccccccccccccEEEEEEEEEEcccccccccccccEEEcEEccccEEEEcccccEEEccccEEEEcccccccccccccccccccccEEEEEEccccccccEEEEEEccHHHHHHcccEEEEEEEEEEcc //