[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : AAS82118.1
DDBJ      :             LSU ribosomal protein L12P (L7/L12)
Swiss-Prot:RL7_THET8    RecName: Full=50S ribosomal protein L7/L12;

Homologs  Archaea  0/68 : Bacteria  735/915 : Eukaryota  18/199 : Viruses  0/175   --->[See Alignment]
a.108.1d.45.1
:125 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   3->125 1dd3A PDBj 3e-17 57.7 %
:RPS:PDB   3->125 1dd3A PDBj 5e-17 51.2 %
:RPS:SCOP  59->125 1ctfA  d.45.1.1 * 1e-12 65.7 %
:HMM:SCOP  3->62 1dd3A1 a.108.1.1 * 5.1e-15 63.2 %
:HMM:SCOP  59->125 1dd3A2 d.45.1.1 * 1e-20 71.6 %
:RPS:PFM   60->125 PF00542 * Ribosomal_L12 1e-08 72.7 %
:HMM:PFM   59->125 PF00542 * Ribosomal_L12 5.6e-28 74.6 67/68  
:HMM:PFM   14->59 PF00428 * Ribosomal_60s 0.00014 45.5 44/88  
:BLT:SWISS 1->125 RL7_THET8 7e-51 100.0 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS82118.1 GT:GENE AAS82118.1 GT:PRODUCT LSU ribosomal protein L12P (L7/L12) GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION complement(1682779..1683156) GB:FROM 1682779 GB:TO 1683156 GB:DIRECTION - GB:PRODUCT LSU ribosomal protein L12P (L7/L12) GB:PROTEIN_ID AAS82118.1 GB:DB_XREF GI:46197706 LENGTH 125 SQ:AASEQ MALDIERIKEELSQATVLELKQLIDALKEAWGVTAAAPVAVAAAPAAGAAAAPAEEKTEFDVILKEAGAKKLEVIKELRAITGLGLKEAKDLAEKGGPVKEGVSKQEAEEIKKKLEAVGAVVELK GT:EXON 1|1-125:0| SW:ID RL7_THET8 SW:DE RecName: Full=50S ribosomal protein L7/L12; SW:GN Name=rplL; OrderedLocusNames=TTHA0210; SW:KW 3D-structure; Complete proteome; Direct protein sequencing;Ribonucleoprotein; Ribosomal protein. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->125|RL7_THET8|7e-51|100.0|125/125| GO:SWS:NREP 2 GO:SWS GO:0030529|"GO:ribonucleoprotein complex"|Ribonucleoprotein| GO:SWS GO:0005840|"GO:ribosome"|Ribosomal protein| TM:NTM 1 TM:REGION 31->52| SEG 35->54|aaapvavaaapaagaaaapa| BL:PDB:NREP 1 BL:PDB:REP 3->125|1dd3A|3e-17|57.7|123/128| RP:PDB:NREP 1 RP:PDB:REP 3->125|1dd3A|5e-17|51.2|123/128| RP:PFM:NREP 1 RP:PFM:REP 60->125|PF00542|1e-08|72.7|66/68|Ribosomal_L12| HM:PFM:NREP 2 HM:PFM:REP 59->125|PF00542|5.6e-28|74.6|67/68|Ribosomal_L12| HM:PFM:REP 14->59|PF00428|0.00014|45.5|44/88|Ribosomal_60s| GO:PFM:NREP 4 GO:PFM GO:0003735|"GO:structural constituent of ribosome"|PF00542|IPR013823| GO:PFM GO:0005622|"GO:intracellular"|PF00542|IPR013823| GO:PFM GO:0005840|"GO:ribosome"|PF00542|IPR013823| GO:PFM GO:0006412|"GO:translation"|PF00542|IPR013823| RP:SCP:NREP 1 RP:SCP:REP 59->125|1ctfA|1e-12|65.7|67/68|d.45.1.1| HM:SCP:REP 3->62|1dd3A1|5.1e-15|63.2|57/57|a.108.1.1|1/1|Ribosomal protein L7/12, oligomerisation (N-terminal) domain| HM:SCP:REP 59->125|1dd3A2|1e-20|71.6|67/71|d.45.1.1|1/1|ClpS-like| OP:NHOMO 789 OP:NHOMOORG 753 OP:PATTERN -------------------------------------------------------------------- 1111-------111------------------1---1------11--11--1-1-11---111--11-111-------1111111111111111111-1111111111111------11-----111111111111111--111-11111111111111-11111-1--111111111111111111111-1111111111111111111111111111111111111111111111111-11111-11111111111111111111111111111111111---------------------------11------------111111111111111111111111-1-1111111111111-11111111111-111111111111111111111111111111111-1111111111111111111111111111111111211111111111111111111----------111111111111111----111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-111111111111111111111-111111-1-1-11----1111111111111111111-111111111111-111111111-11-111111111111111111111111111111111111111111111111111111111111111111111-----1111111111111111111111111111111111111111111-111111---11111--111111111111111--1111111111111111111111--11111111-11111---------1-----1---111-111111111111 ------------------------------------------------------------------------------------------------------------1-------1----------------------------------------------------------2112H-----6334-11--11214 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 123 STR:RPRED 98.4 SQ:SECSTR ##ccHHHHHHHHTTccHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHTTccEEEEEEEcTTcHHHHHHHHHHHHcccHHHHHHHHTTTcEEEEEEcHHHHHHHHHHHHHTTcEEEEc DISOP:02AL 41-52| PSIPRED ccccHHHHHHHHHcccHHHHHHHHHHHHHHHcccccccccccccccccccccHHHHccEEEEEEcccccHHHHHHHHHHHHccccHHHHHHHHcccHHHHHcccHHHHHHHHHHHHHcccEEEEc //