[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : AAS82121.1
DDBJ      :             NAD(P) transhydrogenase subunit alpha 2
Swiss-Prot:             

Homologs  Archaea  2/68 : Bacteria  179/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
:100 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   1->16 PF10031 * DUF2273 0.00044 43.8 16/51  
:BLT:SWISS 5->93 PNTAB_RHORU 4e-12 33.7 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS82121.1 GT:GENE AAS82121.1 GT:PRODUCT NAD(P) transhydrogenase subunit alpha 2 GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION complement(1685232..1685534) GB:FROM 1685232 GB:TO 1685534 GB:DIRECTION - GB:PRODUCT NAD(P) transhydrogenase subunit alpha 2 GB:PROTEIN_ID AAS82121.1 GB:DB_XREF GI:46197709 LENGTH 100 SQ:AASEQ MEFGFWSALYIFVLTAFLGYELITRVPVILHTPLMSGSNFIHGVVVVGAMVVLGHAETGLEKLIGFLGVILGAANAAGGYAVTVRMLEMFERKPGQGGGR GT:EXON 1|1-100:0| BL:SWS:NREP 1 BL:SWS:REP 5->93|PNTAB_RHORU|4e-12|33.7|89/139| TM:NTM 3 TM:REGION 7->29| TM:REGION 36->58| TM:REGION 65->87| SEG 43->54|gvvvvgamvvlg| HM:PFM:NREP 1 HM:PFM:REP 1->16|PF10031|0.00044|43.8|16/51|DUF2273| OP:NHOMO 201 OP:NHOMOORG 182 OP:PATTERN -----------------------------1-------------1------------------------ --111---------11111-1-11131-1111----1-111-1---------------------111-----11111-----1------------1---------1--1------------------------------------11-2111---11------111--11----------------11-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------111111111-1-1--111311111---------------11111111-111--11------------11---1-1--111-----111--111---1111-2111111--1111111-21732----1-1---1-1-2---------1-------1-1112--1-----------------------1-----------------------------------112------------1----1-11-------111---------------------------------------------------------------------------------------------11111-----1--1-------------------------11111-11111-1111-11------------------------111----111--------111111----------------------------------------------1-- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 88-100| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHcccHHHHcHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccc //