[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : AAS82125.1
DDBJ      :             transporter
Swiss-Prot:             

Homologs  Archaea  6/68 : Bacteria  89/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
f.38.1
:379 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  4->67 1pw4A  f.38.1.1 * 1e-04 25.4 %
:HMM:SCOP  1->379 1pw4A_ f.38.1.1 * 4.9e-61 38.2 %
:RPS:PFM   8->122 PF07690 * MFS_1 6e-06 29.6 %
:HMM:PFM   10->220 PF07690 * MFS_1 3.2e-29 29.9 211/353  
:HMM:PFM   213->372 PF07690 * MFS_1 3.1e-14 35.8 159/353  
:BLT:SWISS 15->121 YJJL_ECOLI 5e-10 31.8 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS82125.1 GT:GENE AAS82125.1 GT:PRODUCT transporter GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION 1688480..1689619 GB:FROM 1688480 GB:TO 1689619 GB:DIRECTION + GB:PRODUCT transporter GB:PROTEIN_ID AAS82125.1 GB:DB_XREF GI:46197713 LENGTH 379 SQ:AASEQ MAARVFFLFALGYFLSYFYRSANAVLAKDLSQELGLGPAELGFMTSLFYLAFAAAQLPLGGLLDRVGPRAVTPALLLVAALGSVVFGLAQSFAVLALGRALIGVGMAAALMGSMRAFSLWFPRNYATVSTLLVGLGATGGLMAATPLALLKEALGWRGVFLLGAFVVALVALALYLGVRNTPPGVAWPGGQRGNGLGEVFRNGRLLRVAFLAFAFAGSFLALQTLWAGDYAYHLGLTALEVGNLLFLYSGGAVLGFLVSGYLADRLGTARVLLASALLFALGLLLLLLKALVPAYALLGFFGAFNILTLTQARELVPSHLVGRGTTLVNLFGIGGTFLLQWGVGVAVEALGYALAFGGLLALLLLALGLYLPLLHKSSG GT:EXON 1|1-379:0| BL:SWS:NREP 1 BL:SWS:REP 15->121|YJJL_ECOLI|5e-10|31.8|107/453| TM:NTM 10 TM:REGION 2->24| TM:REGION 40->62| TM:REGION 81->103| TM:REGION 128->150| TM:REGION 157->179| TM:REGION 205->227| TM:REGION 237->259| TM:REGION 277->299| TM:REGION 325->347| TM:REGION 355->376| SEG 70->89|avtpalllvaalgsvvfgla| SEG 127->150|tvstllvglgatgglmaatplall| SEG 158->178|gvfllgafvvalvalalylgv| SEG 204->222|rllrvaflafafagsflal| SEG 272->298|llasallfalgllllllkalvpayall| SEG 349->374|algyalafggllallllalglylpll| RP:PFM:NREP 1 RP:PFM:REP 8->122|PF07690|6e-06|29.6|115/347|MFS_1| HM:PFM:NREP 2 HM:PFM:REP 10->220|PF07690|3.2e-29|29.9|211/353|MFS_1| HM:PFM:REP 213->372|PF07690|3.1e-14|35.8|159/353|MFS_1| GO:PFM:NREP 1 GO:PFM GO:0055085|"GO:transmembrane transport"|PF07690|IPR011701| RP:SCP:NREP 1 RP:SCP:REP 4->67|1pw4A|1e-04|25.4|63/434|f.38.1.1| HM:SCP:REP 1->379|1pw4A_|4.9e-61|38.2|377/447|f.38.1.1|1/1|MFS general substrate transporter| OP:NHOMO 113 OP:NHOMOORG 95 OP:PATTERN -----------------------1-------1------111---------1----------------- --1-------------------------------------------------------------------------------------------------------------------------1--------------11-------------------------------1-----1-------11--------------------------------1---------------------------------------------------------------------------------------------------------------------------------------11--1--1-----------------------1-2------------------------------1-------------------121-11--1-------------1-------------------------------1------111111111111111111211111121-1112---------------1--21---1------------12--11-----------1111111-------1-1-------------------------------------------------------------1------------------------------------------------11---------------------------------------------1-1113441-----------------------------------------222--111------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 377-379| PSIPRED cHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccc //