[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : AAS82131.1
DDBJ      :             hypothetical conserved protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  4/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:159 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   96->152 PF03451 * HELP 0.00025 24.6 57/77  
:HMM:PFM   3->26 PF02683 * DsbD 0.00031 50.0 24/211  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS82131.1 GT:GENE AAS82131.1 GT:PRODUCT hypothetical conserved protein GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION 1696501..1696980 GB:FROM 1696501 GB:TO 1696980 GB:DIRECTION + GB:PRODUCT hypothetical conserved protein GB:PROTEIN_ID AAS82131.1 GB:DB_XREF GI:46197719 LENGTH 159 SQ:AASEQ MRVFLLALAAFLSACTLTLYPEGLSVTYRVDFGGAILRFEPDRGRGATYFVGEEVRFFLTLDRPGWVSLVVQDPDGYTYELDRFHLSRGTHVLPPGPYRYTLIPPRGLHRVRAVYTQSPPSSRVRLEGRYTDWDARLRLYVEASGARAYDVAETYFYVR GT:EXON 1|1-159:0| TM:NTM 1 TM:REGION 1->20| SEG 4->19|fllalaaflsactltl| HM:PFM:NREP 2 HM:PFM:REP 96->152|PF03451|0.00025|24.6|57/77|HELP| HM:PFM:REP 3->26|PF02683|0.00031|50.0|24/211|DsbD| OP:NHOMO 4 OP:NHOMOORG 4 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11-11------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 159-160| PSIPRED cEEEEEHHHHHHccEEEEEEccccEEEEEEEcccEEEEEEEccccccEEEEEEEEEEEEEEccccEEEEEEEcccccEEEEEEEEEccccEEEccccEEEEEccHHHHHHEEEEEEEcccccEEEEEEEEccccHHEEEEEEHHccccccEEEEEEEEc //