[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : AAS82134.1
DDBJ      :             tripartite transporter, small subunit
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  147/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:180 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   40->161 PF04290 * DctQ 6e-15 44.2 %
:HMM:PFM   32->161 PF04290 * DctQ 6.1e-34 35.2 128/133  
:BLT:SWISS 36->164 Y1030_HAEIN 2e-06 24.0 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS82134.1 GT:GENE AAS82134.1 GT:PRODUCT tripartite transporter, small subunit GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION complement(1699694..1700236) GB:FROM 1699694 GB:TO 1700236 GB:DIRECTION - GB:PRODUCT tripartite transporter, small subunit GB:PROTEIN_ID AAS82134.1 GB:DB_XREF GI:46197722 LENGTH 180 SQ:AASEQ MRALLALSRAIDALSEGVGRIIVWLVLVVSLLSAGNALMRYAFRYSSNAYLEAQWYLFSLIFLLGGAYALKHNAHVRIDLVYGRLSKRTQAWIDLVGTLLFLIPMSLGVIYLSWDWVANAVAIREMSPDVGGLPRWPIKIALPVGFALLALQGLSELIKRLAFLTGHLPDWTPEEEGEVV GT:EXON 1|1-180:0| BL:SWS:NREP 1 BL:SWS:REP 36->164|Y1030_HAEIN|2e-06|24.0|125/161| TM:NTM 4 TM:REGION 15->37| TM:REGION 53->72| TM:REGION 99->121| TM:REGION 143->165| SEG 23->33|vwlvlvvslls| RP:PFM:NREP 1 RP:PFM:REP 40->161|PF04290|6e-15|44.2|120/133|DctQ| HM:PFM:NREP 1 HM:PFM:REP 32->161|PF04290|6.1e-34|35.2|128/133|DctQ| OP:NHOMO 201 OP:NHOMOORG 147 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------1---------------------1---1111111-----111-11--------1-1-1--11-1-1-----1-------22-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111111112211-1-111111---------212-122111321122111111-33333421-------------11------------------------------1-----13332------------------------212111---221221121212211----1--------1-111--2---------------------111------11-1---------------11111------113-1-11-----------------2---1--1--------------------------------------------------------------------------------------------1----------13-3--------------------------1--------2----1------------2---111111-1111----------------1-------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 174-178| PSIPRED cHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEEEccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccc //