[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : AAS82140.1
DDBJ      :             nucleoside diphosphate kinase
Swiss-Prot:NDK_THET2    RecName: Full=Nucleoside diphosphate kinase;         Short=NDK;         Short=NDP kinase;         EC=2.7.4.6;AltName: Full=Nucleoside-2-P kinase;

Homologs  Archaea  66/68 : Bacteria  798/915 : Eukaryota  195/199 : Viruses  1/175   --->[See Alignment]
d.58.6
:137 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   1->137 1wkjA PDBj 2e-75 99.3 %
:RPS:PDB   2->137 2cwkB PDBj 4e-58 62.5 %
:RPS:SCOP  1->137 1b4sA  d.58.6.1 * 2e-54 62.0 %
:HMM:SCOP  1->137 1wkjA1 d.58.6.1 * 4.2e-57 59.1 %
:RPS:PFM   2->131 PF00334 * NDK 6e-42 62.3 %
:HMM:PFM   2->135 PF00334 * NDK 3.1e-62 61.2 134/135  
:BLT:SWISS 1->137 NDK_THET2 2e-75 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS82140.1 GT:GENE AAS82140.1 GT:PRODUCT nucleoside diphosphate kinase GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION complement(1704416..1704829) GB:FROM 1704416 GB:TO 1704829 GB:DIRECTION - GB:PRODUCT nucleoside diphosphate kinase GB:PROTEIN_ID AAS82140.1 GB:DB_XREF GI:46197728 LENGTH 137 SQ:AASEQ MERTFVMIKPDGVRRGLVGEILARFERKGFRIAALKLMRISQELAERHYAEHREKPFFPGLVRFITSGPVVAMVLEGPGVVAEVRKMMGATHPKDALPGTIRGDFATTIDENVIHGSATLEDAQREIALFFRPEELL GT:EXON 1|1-137:0| SW:ID NDK_THET2 SW:DE RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP kinase; EC=2.7.4.6;AltName: Full=Nucleoside-2-P kinase; SW:GN Name=ndk; OrderedLocusNames=TT_C1798; SW:KW ATP-binding; Complete proteome; Cytoplasm; Kinase; Magnesium;Metal-binding; Nucleotide metabolism; Nucleotide-binding;Phosphoprotein; Transferase. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->137|NDK_THET2|2e-75|100.0|137/137| GO:SWS:NREP 7 GO:SWS GO:0005524|"GO:ATP binding"|ATP-binding| GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0016301|"GO:kinase activity"|Kinase| GO:SWS GO:0046872|"GO:metal ion binding"|Metal-binding| GO:SWS GO:0009117|"GO:nucleotide metabolic process"|Nucleotide metabolism| GO:SWS GO:0000166|"GO:nucleotide binding"|Nucleotide-binding| GO:SWS GO:0016740|"GO:transferase activity"|Transferase| BL:PDB:NREP 1 BL:PDB:REP 1->137|1wkjA|2e-75|99.3|137/137| RP:PDB:NREP 1 RP:PDB:REP 2->137|2cwkB|4e-58|62.5|136/152| RP:PFM:NREP 1 RP:PFM:REP 2->131|PF00334|6e-42|62.3|130/134|NDK| HM:PFM:NREP 1 HM:PFM:REP 2->135|PF00334|3.1e-62|61.2|134/135|NDK| GO:PFM:NREP 5 GO:PFM GO:0004550|"GO:nucleoside diphosphate kinase activity"|PF00334|IPR001564| GO:PFM GO:0005524|"GO:ATP binding"|PF00334|IPR001564| GO:PFM GO:0006183|"GO:GTP biosynthetic process"|PF00334|IPR001564| GO:PFM GO:0006228|"GO:UTP biosynthetic process"|PF00334|IPR001564| GO:PFM GO:0006241|"GO:CTP biosynthetic process"|PF00334|IPR001564| RP:SCP:NREP 1 RP:SCP:REP 1->137|1b4sA|2e-54|62.0|137/150|d.58.6.1| HM:SCP:REP 1->137|1wkjA1|4.2e-57|59.1|137/0|d.58.6.1|1/1|Nucleoside diphosphate kinase, NDK| OP:NHOMO 1670 OP:NHOMOORG 1060 OP:PATTERN 11-1111111111111-111111111111111111111111111111111111111111111111111 1111111111111111111-111111111111111111111111111111111111111111111111111--------111111111111111--1--1-111111111111111111111112111111111111111111111111111111111111111111111111111111111111111--1111111111111111111111111111111111111111113111111111111111111111-1-11-1---111111-1211----1111111---11111111111--------------111111111----1-------1-1--111111--1--1--1111111--111111-1--121111111111111111111111111111111111-1111-111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111-11111111111111111111111111111111111--1111------11111111111111111-111111111111111111111111121111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111121111111-11111111111111-1--------------------------11111------11 1122434-61123351111111111111111111111111111111-11111111111121111111111111111111111111111-111111122211136331364A8AA9BA5475394BE6F7fgF-F8G4657E64EC46843724E4957799636582223512742443O22232A5881593333332 --------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---- STR:NPRED 137 STR:RPRED 100.0 SQ:SECSTR TEEEEEEEcHHHHHTTcHHHHHHHHHHHTcEEEEEEEEcccHHHHHHHTGGGTTcTTHHHHHHHHTcccEEEEEEEEETHHHHHHHHHccccGGGccTTcHHHHHccccccccEEEcccHHHHHHHHHHHccGGGcc PSIPRED ccEEEEEEccHHHHcccHHHHHHHHHHcccEEEEEEEEEccHHHHHHHHHHHcccccHHHHHHHHccccEEEEEEEcccHHHHHHHHHccccHHHcccccccccccccccccEEEccccHHHHHHHHHHHccHHHcc //