[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : AAS82156.1
DDBJ      :             bacitracin resistance protein (putative undecaprenol kinase)
Swiss-Prot:UPPP_THET2   RecName: Full=Undecaprenyl-diphosphatase;         EC=3.6.1.27;AltName: Full=Undecaprenyl pyrophosphate phosphatase;AltName: Full=Bacitracin resistance protein;

Homologs  Archaea  1/68 : Bacteria  396/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:261 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   8->251 PF02673 * BacA 5e-18 34.9 %
:HMM:PFM   8->254 PF02673 * BacA 2.1e-74 45.0 242/259  
:BLT:SWISS 1->261 UPPP_THET2 e-101 100.0 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS82156.1 GT:GENE AAS82156.1 GT:PRODUCT bacitracin resistance protein (putative undecaprenol kinase) GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION complement(1723105..1723890) GB:FROM 1723105 GB:TO 1723890 GB:DIRECTION - GB:PRODUCT bacitracin resistance protein (putative undecaprenol kinase) GB:PROTEIN_ID AAS82156.1 GB:DB_XREF GI:46197744 LENGTH 261 SQ:AASEQ MGRVSAWEALLLGVVEGLTEFLPVSSTGHLTLLFHLLGLPVEEDPFLKTFLVAIQLGAILAVLLLYGRRLAADRALWLRIAVAFVPTGVIGFFFYPLIKGVILGNDAVVAFFLFFVGAVLLFADRLAERAQYQDVKALPLARVAWIGVFQGLAALFPGTSRSGATILGGLLLGLNRQAAAEFSFLLALPTMFAAVGYDLWKSAPEVPEGGWSLLLLGFLAALATALVTVRWMLAFVARHGFRPFALYRMALAAVYAFFFLR GT:EXON 1|1-261:0| SW:ID UPPP_THET2 SW:DE RecName: Full=Undecaprenyl-diphosphatase; EC=3.6.1.27;AltName: Full=Undecaprenyl pyrophosphate phosphatase;AltName: Full=Bacitracin resistance protein; SW:GN Name=uppP; Synonyms=bacA, upk; OrderedLocusNames=TT_C1814; SW:KW Antibiotic resistance; Cell inner membrane; Cell membrane; Cell shape;Cell wall biogenesis/degradation; Complete proteome; Hydrolase;Membrane; Peptidoglycan synthesis; Transmembrane. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->261|UPPP_THET2|e-101|100.0|261/261| GO:SWS:NREP 9 GO:SWS GO:0046677|"GO:response to antibiotic"|Antibiotic resistance| GO:SWS GO:0005886|"GO:plasma membrane"|Cell inner membrane| GO:SWS GO:0005886|"GO:plasma membrane"|Cell membrane| GO:SWS GO:0008360|"GO:regulation of cell shape"|Cell shape| GO:SWS GO:0007047|"GO:cellular cell wall organization"|Cell wall biogenesis/degradation| GO:SWS GO:0016787|"GO:hydrolase activity"|Hydrolase| GO:SWS GO:0016020|"GO:membrane"|Membrane| GO:SWS GO:0009252|"GO:peptidoglycan biosynthetic process"|Peptidoglycan synthesis| GO:SWS GO:0016021|"GO:integral to membrane"|Transmembrane| TM:NTM 8 TM:REGION 3->25| TM:REGION 46->67| TM:REGION 76->98| TM:REGION 105->127| TM:REGION 135->157| TM:REGION 170->192| TM:REGION 213->235| TM:REGION 240->261| SEG 25->39|sstghltllfhllgl| SEG 68->81|rrlaadralwlria| SEG 107->123|avvafflffvgavllfa| SEG 167->174|lgglllgl| SEG 213->226|llllgflaalatal| RP:PFM:NREP 1 RP:PFM:REP 8->251|PF02673|5e-18|34.9|238/254|BacA| HM:PFM:NREP 1 HM:PFM:REP 8->254|PF02673|2.1e-74|45.0|242/259|BacA| GO:PFM:NREP 3 GO:PFM GO:0016020|"GO:membrane"|PF02673|IPR003824| GO:PFM GO:0016311|"GO:dephosphorylation"|PF02673|IPR003824| GO:PFM GO:0050380|"GO:undecaprenyl-diphosphatase activity"|PF02673|IPR003824| OP:NHOMO 442 OP:NHOMOORG 397 OP:PATTERN -------------------------------------1------------------------------ -1---------------------------------------222---1------1--1----11---1111-------1----11111------11---1111--111-1--------------------1------11-1------------------------------------------11111-----1222232121323332--11--233-111---------111--1111-11---11-11-----11111---11--111----1111---1---1--111111111111111111------11111111111-111-------1-1-222----11111-111-111-----1-111--11-1-1111-------1111111111111111111111-11111111111112211111111111-----11111----------------111-------------------------------11111----222222111112211111111221211111---111112111-111111111111111111111111---1-11-111111111-1-1----1-----1--11111111----------11-1--1111-11-111-1111--11111-211111--1---1--------111-1---------------------------------1111-----------------1------11-111111111111-------------1-111---------------1111112111111111111-1----11-1---------1--------------11111111111111--------11----------------------------------------------1-1 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 260-262| PSIPRED ccHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHccccccccHHHccHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccEEHHHHHHHHHHHHHHHHHc //