[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : AAS82174.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:143 amino acids
:PSIPRED
:DISOPRED
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS82174.1 GT:GENE AAS82174.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION complement(1740509..1740940) GB:FROM 1740509 GB:TO 1740940 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAS82174.1 GB:DB_XREF GI:46197762 LENGTH 143 SQ:AASEQ MAEVNMNAKRMLVWVWLLLAPALGGSLGYGFLGFQGAWQGGGGGFGTFQGVALGGESWGGPRGYGGVFLAGAWLPVGPGVFLLPALGLGGESGGFLLDLGVRGFGFFREEGGWVFGVGAGYALPLESSGGGWYVRLAFGGGRP GT:EXON 1|1-143:0| TM:NTM 2 TM:REGION 11->33| TM:REGION 66->88| SEG 12->55|lvwvwlllapalggslgygflgfqgawqgggggfgtfqgvalgg| SEG 82->118|llpalglggesggflldlgvrgfgffreeggwvfgvg| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-7, 142-143| PSIPRED cccccccHHHHHHHHHHHHHHHccccccccEEccccccccccccccccEEEEEcccccccccccccEEEEEEcccccccEEEEEccccccccccEEEEEccccEEEEEccccEEEEEcccEEEEEEcccccEEEEEEEccccc //