[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : AAS82178.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.24.1
:116 amino acids
:PSIPRED
:DISOPRED
:HMM:SCOP  6->116 1oqwA_ d.24.1.1 * 4.2e-20 34.0 %
:HMM:PFM   4->22 PF07963 * N_methyl 3.9e-08 52.6 19/20  
:PROS 4->24|PS00409|PROKAR_NTER_METHYL
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS82178.1 GT:GENE AAS82178.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION 1744602..1744952 GB:FROM 1744602 GB:TO 1744952 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAS82178.1 GB:DB_XREF GI:46197766 LENGTH 116 SQ:AASEQ MRAKGFTLIELAIVIVIIGILVAIAVPRFVDLTDQANQANVDATAAAVRSAYAIATVQAKGIPTCDQVFANPEGGSTSGSTWTSSDNSTTVSCNASADTFTISRGGKTRTLNLTVN GT:EXON 1|1-116:0| PROS 4->24|PS00409|PROKAR_NTER_METHYL|PDOC00342| TM:NTM 1 TM:REGION 7->29| SEG 8->26|lielaiviviigilvaiav| SEG 34->56|dqanqanvdataaavrsayaiat| SEG 74->92|ggstsgstwtssdnsttvs| HM:PFM:NREP 1 HM:PFM:REP 4->22|PF07963|3.9e-08|52.6|19/20|N_methyl| HM:SCP:REP 6->116|1oqwA_|4.2e-20|34.0|106/144|d.24.1.1|1/1|Pili subunits| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4, 78-80| PSIPRED cccccHHHHHHHHHHHHHHHHHHHHHcHHccccccccccccHHHHHHHHHHHHEEEEEccccccHHHHHcccccccccccEEEcccccEEEEEcccccEEEEEccccEEEEEEEEc //