[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : AAS82188.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:155 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   33->148 PF04350 * PilO 1.2e-05 20.0 115/144  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS82188.1 GT:GENE AAS82188.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION 1753275..1753742 GB:FROM 1753275 GB:TO 1753742 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAS82188.1 GB:DB_XREF GI:46197776 LENGTH 155 SQ:AASEQ MKLPPWLWYLLPLAVLLWSASGVLSAYGRYQKARLQVQALEREVEALTRNLPQALGEAPVPLEALPLLYEALFRLAEEKGLQVQSLDPGEAAPTGGVRAWRVRLLLEGPYAGVLGYLEGLPGLGKPLWVEAYTLEPVGERGERLALDLVLRVLAP GT:EXON 1|1-155:0| TM:NTM 1 TM:REGION 6->27| SEG 3->18|lppwlwyllplavllw| SEG 54->72|algeapvplealpllyeal| SEG 143->154|rlaldlvlrvla| HM:PFM:NREP 1 HM:PFM:REP 33->148|PF04350|1.2e-05|20.0|115/144|PilO| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 17-17,53-53,59-60,62-62,67-67,143-143,146-146| PSIPRED ccccHHHHHHHHHHHHHHccccHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHcccEEEEccccccccccccEEEEEEEEEcccHHHHHHHHHccccccccEEEEEEEccccHHHHHHHHHHHHHHHHcc //