[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : AAS82210.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:79 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   6->67 PF03704 * BTAD 0.00018 24.6 61/146  
:COIL
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS82210.1 GT:GENE AAS82210.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION complement(1772120..1772359) GB:FROM 1772120 GB:TO 1772359 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAS82210.1 GB:DB_XREF GI:46197798 LENGTH 79 SQ:AASEQ MPKTEARKRVRKERLREVLEVLLDELEEASRAFQSAWKRAKENPEDEEAWGELQVWVSVLGVKAKSLEELLEEEAFLTS GT:EXON 1|1-79:0| COIL:NAA 35 COIL:NSEG 1 COIL:REGION 9->43| SEG 5->29|earkrvrkerlrevlevlldeleea| SEG 67->74|leelleee| HM:PFM:NREP 1 HM:PFM:REP 6->67|PF03704|0.00018|24.6|61/146|BTAD| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-11, 34-48| PSIPRED cccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccc //