[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : AAS82211.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:62 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   5->56 PF01576 * Myosin_tail_1 0.0001 26.9 52/859  
:COIL
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS82211.1 GT:GENE AAS82211.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION complement(1772361..1772549) GB:FROM 1772361 GB:TO 1772549 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAS82211.1 GB:DB_XREF GI:46197799 LENGTH 62 SQ:AASEQ MGNRRLRKSVESYQARIREHQAKIEEELRRPEPRWELIRYWEKEIRTYPGRVERLLRRMGRR GT:EXON 1|1-62:0| COIL:NAA 28 COIL:NSEG 1 COIL:REGION 3->30| SEG 24->39|ieeelrrpeprwelir| SEG 50->61|grverllrrmgr| HM:PFM:NREP 1 HM:PFM:REP 5->56|PF01576|0.0001|26.9|52/859|Myosin_tail_1| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-12, 19-28, 60-62| PSIPRED cccHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHccc //