[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : AAS82228.1
DDBJ      :             exopolyphosphatase family protein
Swiss-Prot:             

Homologs  Archaea  4/68 : Bacteria  351/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.107.1
:324 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   28->316 3dmaA PDBj 1e-19 32.0 %
:RPS:PDB   17->316 3devA PDBj 1e-35 25.0 %
:RPS:SCOP  30->320 1ir6A  c.107.1.2 * 2e-26 19.9 %
:HMM:SCOP  26->318 1k20A_ c.107.1.1 * 6.1e-53 37.6 %
:RPS:PFM   28->163 PF01368 * DHH 5e-08 38.6 %
:HMM:PFM   27->163 PF01368 * DHH 2.6e-15 25.7 105/117  
:HMM:PFM   255->310 PF02272 * DHHA1 7.9e-12 39.3 56/68  
:BLT:SWISS 28->302 NRNA_BACSU 5e-24 31.5 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS82228.1 GT:GENE AAS82228.1 GT:PRODUCT exopolyphosphatase family protein GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION 1793437..1794411 GB:FROM 1793437 GB:TO 1794411 GB:DIRECTION + GB:PRODUCT exopolyphosphatase family protein GB:PROTEIN_ID AAS82228.1 GB:DB_XREF GI:46197816 LENGTH 324 SQ:AASEQ MDGNAPEPRYWEKMRLVAEVLKAVEGPIYIATHVDPDGDAIGSSLGLYRALKALGKEAYWVADPPRFLRFLPKEEEYSDPVEKLPPGATLVALDSAEPSRVVGVPVEGFVINIDHHGTNPRFGHLHVVDPSKAATAQMVKDLIDLLGVEWTAEIATPVLTGILTDTGNFRFANTTPEVLRVAAELLGYGVKLAELTDRLQFRPPSYFRLMGQVLSTVAFHFGGLLVTAHLPEEAGAEEDSDDFVGLIRYVEGSVVSVFLRKREEGVKVSIRSRGGVSAQNIALKLGGGGHVPAAGATLKGLDLDQAYERVLEAVREELTRAGYL GT:EXON 1|1-324:0| BL:SWS:NREP 1 BL:SWS:REP 28->302|NRNA_BACSU|5e-24|31.5|270/313| BL:PDB:NREP 1 BL:PDB:REP 28->316|3dmaA|1e-19|32.0|284/329| RP:PDB:NREP 1 RP:PDB:REP 17->316|3devA|1e-35|25.0|292/310| RP:PFM:NREP 1 RP:PFM:REP 28->163|PF01368|5e-08|38.6|132/157|DHH| HM:PFM:NREP 2 HM:PFM:REP 27->163|PF01368|2.6e-15|25.7|105/117|DHH| HM:PFM:REP 255->310|PF02272|7.9e-12|39.3|56/68|DHHA1| GO:PFM:NREP 2 GO:PFM GO:0016787|"GO:hydrolase activity"|PF01368|IPR001667| GO:PFM GO:0030145|"GO:manganese ion binding"|PF01368|IPR001667| RP:SCP:NREP 1 RP:SCP:REP 30->320|1ir6A|2e-26|19.9|286/385|c.107.1.2| HM:SCP:REP 26->318|1k20A_|6.1e-53|37.6|274/310|c.107.1.1|1/1|DHH phosphoesterases| OP:NHOMO 491 OP:NHOMOORG 355 OP:PATTERN -------------------------------------------------------1-11-1------- 11---111111-1-11111-11--1-11111111111111-111----------------11--1-1-----------1111111111111111111--11111112111---------------1111111111111111---11-------------------------------------1111111112222222222222222212222222222221222222222112222222222222222222222222211222222221121111112221111122211221212211111111111111211111111111122222222222222221222222121222111121111111122111111------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------211122211111111111111------111--------------------1111---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------1111111111222212-1-122112221-1222---1111121212111 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 307 STR:RPRED 94.8 SQ:SECSTR ###########HHHHHHHHHHHHHHTEEEEEccccccHHHHHHHHHHHHHHHHHcTTcEEEEcccGGGTTTcccccccccTTTHHHTcEEEEEccccGGGccGGGGcccEEEEEccccccccccEEEEcTTcccHHHHHHHHHHTTTTTccHHHHHHHHHHHHHHTTTTTcTTccHHHHHHHHHHHHccccHHHHHHHHcccccGGGHHHHHHHHccTccEEEEEEcHHHHHHTTcHHHHTTcGGGcTTcTTccEEEEEEEccccEEEEEEEccccccHHHHHHTTcEEETTEEEEEEccHHHHHHHHHHHHHTTcHT###### DISOP:02AL 1-2| PSIPRED cccccccHHHHHHHHHHHHHHHHHcccEEEEEcccccHHHHHHHHHHHHHHHHcccEEEEEEccHHHHHHHHHHcccccHHHccccccEEEEEEcccHHHccccccccEEEEEEEcccccccccEEEEcccccHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHccccHHHHHHHHHcccHHHHHHHHHHHHHcEEEEccEEEEEEEHHHcccHHHHHHHHHHHcccccEEEEEEEEEEccEEEEEEEEcccccHHHHHHHHccccccccccEEEccccHHHHHHHHHHHHHHHHHHHccc //