[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermus thermophilus HB27 (tthe0)
Gene : AAS82233.1
DDBJ      :             hypothetical conserved protein
Swiss-Prot:             

Homologs  Archaea  7/68 : Bacteria  3/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
b.122.1
:121 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->121 2dp9A PDBj 5e-69 100.0 %
:RPS:PDB   3->121 2dp9A PDBj 4e-08 100.0 %
:RPS:SCOP  2->120 1wk2A  b.122.1.5 * 1e-28 98.8 %
:HMM:SCOP  1->120 2dp9A1 b.122.1.5 * 1.4e-30 34.2 %
:HMM:PFM   10->80 PF04266 * ASCH 8.2e-13 28.6 70/104  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAS82233.1 GT:GENE AAS82233.1 GT:PRODUCT hypothetical conserved protein GT:DATABASE GIB00176CH01 GT:ORG tthe0 GB:ACCESSION GIB00176CH01 GB:LOCATION complement(1799405..1799770) GB:FROM 1799405 GB:TO 1799770 GB:DIRECTION - GB:PRODUCT hypothetical conserved protein GB:PROTEIN_ID AAS82233.1 GB:DB_XREF GI:46197821 LENGTH 121 SQ:AASEQ MERPKLGLIVREPYASLIVDGRKVWEIRRRKTRHRGPLGIVSGGRLIGQADLVGVEGPFSVEELLAHQEKHLAEEAFLRAYAKDEPLYAWVLENAFRYEKPLHVPRRPGRVMFVDLSEVRW GT:EXON 1|1-121:0| BL:PDB:NREP 1 BL:PDB:REP 1->121|2dp9A|5e-69|100.0|121/124| RP:PDB:NREP 1 RP:PDB:REP 3->121|2dp9A|4e-08|100.0|119/124| HM:PFM:NREP 1 HM:PFM:REP 10->80|PF04266|8.2e-13|28.6|70/104|ASCH| RP:SCP:NREP 1 RP:SCP:REP 2->120|1wk2A|1e-28|98.8|83/84|b.122.1.5| HM:SCP:REP 1->120|2dp9A1|1.4e-30|34.2|120/0|b.122.1.5|1/1|PUA domain-like| OP:NHOMO 10 OP:NHOMOORG 10 OP:PATTERN -----------------------1------------------------------111111-------- -------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------------11------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 121 STR:RPRED 100.0 SQ:SECSTR ccccccEEEccTTHHHHHHTTcccEEEEcccccccEEEEEEETTEEEEEEEEEEEEEEEcHHHHGGGHHHHcccHHHHHHHHTTccEEEEEEEEEEEEEEEEEcccTTTcccccccTTccc DISOP:02AL 1-4| PSIPRED ccccccccEEEccHHHEEEcccEEEEEEccccccccEEEEEEccEEEEEEEEEEEcccccHHHHHHHHHHccccHHHHHHHccccEEEEEEEccHHHcccccccccccccEEEEEHHHccc //